Ribose 5-phosphate isomerase B

Details

Name
Ribose 5-phosphate isomerase B
Synonyms
  • Sugar-phosphate isomerase
Gene Name
Not Available
Organism
Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099)
Amino acid sequence
>lcl|BSEQ0012196|Ribose 5-phosphate isomerase B
MKIAIASDHAAFELKEKVKNYLLGKGIEVEDHGTYSEESVDYPDYAKKVVQSILSNEADF
GILLCGTGLGMSIAANRYRGIRAALCLFPDMARLARSHNNANILVLPGRLIGAELAFWIV
DTFLSTPFDGGRHERRIRKIDEV
Number of residues
143
Molecular Weight
15867.05
Theoretical pI
6.94
GO Classification
Functions
ribose-5-phosphate isomerase activity
Processes
carbohydrate metabolic process / pentose-phosphate shunt
General Function
Ribose-5-phosphate isomerase activity
Specific Function
Not Available
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Not Available
Gene sequence
>lcl|BSEQ0012197|Ribose 5-phosphate isomerase B
GTGAAGATCGCTATTGCATCGGACCACGCAGCTTTTGAACTGAAAGAGAAGGTGAAGAAC
TACCTTCTGGGCAAGGGAATAGAAGTGGAAGATCACGGTACCTATTCCGAGGAATCCGTT
GATTATCCGGACTACGCAAAAAAAGTTGTTCAATCCATTCTGTCGAACGAAGCGGATTTT
GGAATCCTTTTGTGTGGGACAGGGCTCGGGATGTCAATTGCTGCAAACAGGTACAGGGGC
ATAAGAGCAGCTCTCTGTCTTTTCCCGGACATGGCAAGACTCGCGAGATCGCACAACAAT
GCAAACATCCTCGTTCTTCCGGGAAGGCTCATCGGAGCAGAGCTCGCTTTCTGGATAGTG
GATACCTTCCTTTCAACACCCTTCGATGGAGGAAGGCACGAAAGGAGAATCAGAAAGATC
GATGAGGTTTAA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDQ9X0G9
UniProtKB Entry NameQ9X0G9_THEMA
GenBank Gene IDAE000512
General References
  1. Nelson KE, Clayton RA, Gill SR, Gwinn ML, Dodson RJ, Haft DH, Hickey EK, Peterson JD, Nelson WC, Ketchum KA, McDonald L, Utterback TR, Malek JA, Linher KD, Garrett MM, Stewart AM, Cotton MD, Pratt MS, Phillips CA, Richardson D, Heidelberg J, Sutton GG, Fleischmann RD, Eisen JA, White O, Salzberg SL, Smith HO, Venter JC, Fraser CM: Evidence for lateral gene transfer between Archaea and bacteria from genome sequence of Thermotoga maritima. Nature. 1999 May 27;399(6734):323-9. [PubMed:10360571]
  2. Latif H, Lerman JA, Portnoy VA, Tarasova Y, Nagarajan H, Schrimpe-Rutledge AC, Smith RD, Adkins JN, Lee DH, Qiu Y, Zengler K: The genome organization of Thermotoga maritima reflects its lifestyle. PLoS Genet. 2013 Apr;9(4):e1003485. doi: 10.1371/journal.pgen.1003485. Epub 2013 Apr 25. [PubMed:23637642]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB03661Cysteinesulfonic AcidexperimentalunknownDetails