GTPase Der

Details

Name
GTPase Der
Synonyms
  • engA
  • GTP-binding protein EngA
  • TmDer
Gene Name
der
Organism
Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099)
Amino acid sequence
>lcl|BSEQ0016581|GTPase Der
MATVLIVGRPNVGKSTLFNKLVKKKKAIVEDEEGVTRDPVQDTVEWYGKTFKLVDTCGVF
DNPQDIISQKMKEVTLNMIREADLVLFVVDGKRGITKEDESLADFLRKSTVDTILVANKA
ENLREFEREVKPELYSLGFGEPIPVSAEHNINLDTLLETIIKKLEEKGLDLESKPEITDA
IKVAIVGRPNVGKSTLFNAILNKERALVSPIPGTTRDPVDDEVFIDGRKYVFVDTAGLRR
KSRVEPRTVEKYSNYRVVDSIEKADVVVIVLDATQGITRQDQRIAGLVERRGRASVVVFN
KWDLVEHREKRYDEFTKLFREKLYFIDYSPLIFTSADKGWNIDRVIDAINLAYASYTTKV
PSSAINSALQKVLAFTNLPRGLKIFFGLQVDIKPPTFLFFVNSIEKVKNPQKIFLRKLIR
DYVFPFEGSPIFLKFKRSR
Number of residues
439
Molecular Weight
50014.38
Theoretical pI
9.69
GO Classification
Functions
GTP binding
Processes
ribosome biogenesis
General Function
Gtp binding
Specific Function
GTPase that plays an essential role in the late steps of ribosome biogenesis (By similarity). Has GTPase activity but no ATPase activity. GTP, GDP, and dGTP but not GMP, ATP, CTP, and UTP compete for GTP binding.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Not Available
Gene sequence
>lcl|BSEQ0016582|GTPase Der (der)
ATGGCGACGGTTCTGATAGTTGGTAGACCAAACGTTGGAAAGTCTACTCTGTTCAACAAG
CTGGTAAAGAAGAAAAAGGCTATTGTCGAAGACGAAGAAGGGGTCACCCGTGACCCCGTT
CAAGATACTGTAGAGTGGTACGGGAAAACCTTTAAACTCGTGGACACCTGTGGAGTCTTC
GACAATCCACAGGACATCATTTCCCAAAAGATGAAGGAAGTTACCCTGAACATGATCAGA
GAAGCTGATCTCGTTCTGTTCGTTGTCGATGGAAAAAGAGGAATTACAAAAGAAGACGAA
TCGCTTGCCGATTTTCTCAGGAAATCCACCGTTGATACTATCCTTGTGGCGAACAAAGCG
GAAAATCTCAGAGAGTTCGAAAGAGAAGTGAAGCCGGAGCTTTACAGTTTAGGATTTGGA
GAACCAATACCCGTTTCTGCAGAGCACAACATAAATCTCGATACTCTCCTGGAGACGATC
ATCAAAAAGCTCGAAGAAAAAGGGCTGGATTTAGAATCAAAGCCCGAAATCACCGACGCA
ATAAAAGTTGCCATCGTTGGCCGACCGAACGTGGGAAAATCCACACTCTTCAACGCTATA
TTGAACAAAGAACGAGCTCTTGTGTCACCGATACCTGGAACAACGAGGGATCCCGTTGAC
GACGAAGTGTTTATAGACGGAAGAAAATACGTATTCGTTGACACGGCTGGTTTGAGGAGA
AAATCCAGGGTCGAACCCAGGACTGTTGAAAAATACAGCAACTACAGGGTTGTGGACAGC
ATAGAAAAAGCGGACGTTGTTGTGATAGTTCTTGATGCAACTCAGGGTATCACAAGACAG
GACCAGAGAATAGCCGGCCTTGTGGAAAGACGAGGGAGAGCCAGCGTCGTTGTTTTCAAC
AAATGGGATCTCGTTGAACACCGTGAAAAAAGGTACGACGAATTCACCAAATTATTCAGA
GAGAAGCTCTATTTCATCGATTACAGTCCGCTTATCTTTACCTCCGCTGACAAAGGCTGG
AACATAGACAGAGTGATAGACGCTATCAATTTAGCGTACGCTTCTTACACAACGAAAGTG
CCGTCCAGTGCCATTAATTCGGCTCTTCAGAAAGTGCTCGCGTTCACGAATCTCCCTCGT
GGTCTCAAGATCTTTTTCGGTCTTCAGGTGGACATAAAACCGCCTACTTTTCTCTTCTTT
GTGAACAGCATAGAAAAGGTAAAAAATCCACAAAAGATTTTCCTCAGAAAACTGATCAGG
GACTACGTTTTTCCGTTCGAGGGATCTCCTATATTCTTGAAGTTCAAGAGGAGCAGGTGA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDQ9X1F8
UniProtKB Entry NameDER_THEMA
GenBank Protein ID4982010
GenBank Gene IDAE000512
General References
  1. Nelson KE, Clayton RA, Gill SR, Gwinn ML, Dodson RJ, Haft DH, Hickey EK, Peterson JD, Nelson WC, Ketchum KA, McDonald L, Utterback TR, Malek JA, Linher KD, Garrett MM, Stewart AM, Cotton MD, Pratt MS, Phillips CA, Richardson D, Heidelberg J, Sutton GG, Fleischmann RD, Eisen JA, White O, Salzberg SL, Smith HO, Venter JC, Fraser CM: Evidence for lateral gene transfer between Archaea and bacteria from genome sequence of Thermotoga maritima. Nature. 1999 May 27;399(6734):323-9. [PubMed:10360571]
  2. Hwang J, Inouye M: An essential GTPase, der, containing double GTP-binding domains from Escherichia coli and Thermotoga maritima. J Biol Chem. 2001 Aug 17;276(33):31415-21. Epub 2001 May 31. [PubMed:11387344]
  3. Robinson VL, Hwang J, Fox E, Inouye M, Stock AM: Domain arrangement of Der, a switch protein containing two GTPase domains. Structure. 2002 Dec;10(12):1649-58. [PubMed:12467572]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB04315Guanosine-5'-DiphosphateexperimentalunknownDetails