Putative ribosome biogenesis GTPase RsgA

Details

Name
Putative ribosome biogenesis GTPase RsgA
Synonyms
  • 3.6.1.-
  • yjeQ
Gene Name
rsgA
Organism
Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099)
Amino acid sequence
>lcl|BSEQ0012292|Putative ribosome biogenesis GTPase RsgA
MNLRRRGIVVSFHSNMVTVEDEETGERILCKLRGKFRLQNLKIYVGDRVEYTPDETGSGV
IENVLHRKNLLTKPHVANVDQVILVVTVKMPETSTYIIDKFLVLAEKNELETVMVINKMD
LYDEDDLRKVRELEEIYSGLYPIVKTSAKTGMGIEELKEYLKGKISTMAGLSGVGKSSLL
NAINPGLKLRVSEVSEKLQRGRHTTTTAQLLKFDFGGYVVDTPGFANLEINDIEPEELKH
YFKEFGDKQCFFSDCNHVDEPECGVKEAVENGEIAESRYENYVKMFYELLGRRKK
Number of residues
295
Molecular Weight
33641.39
Theoretical pI
5.76
GO Classification
Functions
GTP binding / GTPase activity / metal ion binding
General Function
Metal ion binding
Specific Function
May play a role in 30S ribosomal subunit biogenesis. Unusual circulary permuted GTPase that catalyzes rapid hydrolysis of GTP with a slow catalytic turnover.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Cytoplasmic
Gene sequence
>lcl|BSEQ0012293|Putative ribosome biogenesis GTPase RsgA (rsgA)
ATGAACTTGAGAAGAAGAGGAATAGTGGTGAGTTTTCACTCGAACATGGTCACGGTCGAA
GACGAGGAAACTGGTGAAAGAATCCTCTGCAAACTGAGGGGGAAATTTCGCCTGCAGAAT
CTCAAGATATACGTTGGAGACAGGGTGGAGTACACACCGGATGAAACAGGATCCGGAGTC
ATAGAGAACGTGCTACACAGGAAAAATCTACTCACCAAACCTCACGTCGCCAATGTGGAT
CAAGTGATTCTCGTGGTAACGGTGAAAATGCCGGAAACTTCGACCTACATAATCGATAAA
TTTCTTGTTCTCGCTGAAAAGAACGAACTGGAAACGGTGATGGTCATCAACAAGATGGAC
CTCTACGATGAAGACGATCTGAGGAAGGTAAGAGAGCTGGAAGAGATCTATTCTGGACTC
TATCCAATCGTGAAAACCAGTGCGAAAACCGGAATGGGAATCGAAGAGCTCAAGGAATAT
CTGAAGGGAAAGATCAGCACGATGGCCGGACTCTCCGGAGTTGGAAAAAGTAGCTTGCTC
AACGCCATAAATCCCGGTTTGAAATTACGGGTGAGCGAAGTTTCAGAGAAACTCCAAAGG
GGAAGGCATACTACAACAACTGCCCAGCTCTTGAAATTCGATTTCGGAGGTTACGTAGTC
GATACTCCGGGTTTCGCAAATCTGGAGATCAACGACATAGAACCCGAGGAACTGAAACAC
TACTTCAAGGAATTTGGAGACAAACAGTGTTTCTTCTCGGACTGCAACCACGTGGATGAA
CCGGAGTGTGGAGTGAAAGAAGCCGTGGAGAACGGAGAAATCGCAGAAAGTCGATACGAA
AACTACGTGAAGATGTTTTACGAGCTTCTGGGAAGGAGGAAAAAGTAA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDQ9X242
UniProtKB Entry NameRSGA_THEMA
GenBank Gene IDAE000512
General References
  1. Nelson KE, Clayton RA, Gill SR, Gwinn ML, Dodson RJ, Haft DH, Hickey EK, Peterson JD, Nelson WC, Ketchum KA, McDonald L, Utterback TR, Malek JA, Linher KD, Garrett MM, Stewart AM, Cotton MD, Pratt MS, Phillips CA, Richardson D, Heidelberg J, Sutton GG, Fleischmann RD, Eisen JA, White O, Salzberg SL, Smith HO, Venter JC, Fraser CM: Evidence for lateral gene transfer between Archaea and bacteria from genome sequence of Thermotoga maritima. Nature. 1999 May 27;399(6734):323-9. [PubMed:10360571]
  2. Shin DH, Lou Y, Jancarik J, Yokota H, Kim R, Kim SH: Crystal structure of YjeQ from Thermotoga maritima contains a circularly permuted GTPase domain. Proc Natl Acad Sci U S A. 2004 Sep 7;101(36):13198-203. Epub 2004 Aug 26. [PubMed:15331784]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB04315Guanosine-5'-DiphosphateexperimentalunknownDetails