Prostaglandin D2 receptor 2

Details

Name
Prostaglandin D2 receptor 2
Synonyms
  • Chemoattractant receptor-homologous molecule expressed on Th2 cells
  • CRTH2
  • DL1R
  • G-protein coupled receptor 44
  • GPR44
Gene Name
PTGDR2
Organism
Humans
Amino acid sequence
>lcl|BSEQ0037246|Prostaglandin D2 receptor 2
MSANATLKPLCPILEQMSRLQSHSNTSIRYIDHAAVLLHGLASLLGLVENGVILFVVGCR
MRQTVVTTWVLHLALSDLLASASLPFFTYFLAVGHSWELGTTFCKLHSSIFFLNMFASGF
LLSAISLDRCLQVVRPVWAQNHRTVAAAHKVCLVLWALAVLNTVPYFVFRDTISRLDGRI
MCYYNVLLLNPGPDRDATCNSRQVALAVSKFLLAFLVPLAIIASSHAAVSLRLQHRGRRR
PGRFVRLVAAVVAAFALCWGPYHVFSLLEARAHANPGLRPLVWRGLPFVTSLAFFNSVAN
PVLYVLTCPDMLRKLRRSLRTVLESVLVDDSELGGAGSSRRRRTSSTARSASPLALCSRP
EEPRGPARLLGWLLGSCAASPQTGPLNRALSSTSS
Number of residues
395
Molecular Weight
43267.15
Theoretical pI
10.95
GO Classification
Functions
G-protein coupled receptor activity / neuropeptide binding / prostaglandin D receptor activity / prostaglandin F receptor activity / prostaglandin J receptor activity
Processes
adenylate cyclase-inhibiting G-protein coupled receptor signaling pathway / calcium-mediated signaling / chemotaxis / G-protein coupled receptor signaling pathway / G-protein coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger / immune response / negative regulation of male germ cell proliferation / neuropeptide signaling pathway / positive regulation of G-protein coupled receptor protein signaling pathway / synaptic transmission
Components
integral component of plasma membrane / intracellular / neuron projection / plasma membrane
General Function
Prostaglandin j receptor activity
Specific Function
Receptor for prostaglandin D2 (PGD2). Coupled to the G(i)-protein. Receptor activation may result in pertussis toxin-sensitive decreases in cAMP levels and Ca(2+) mobilization. PI3K signaling is also implicated in mediating PTGDR2 effects. PGD2 induced receptor internalization. CRTH2 internalization can be regulated by diverse kinases such as, PKC, PKA, ADRBK1/GRK2, GPRK5/GRK5 and GRK6. Receptor activation is responsible, at least in part, in immune regulation and allergic/inflammation responses.
Pfam Domain Function
Transmembrane Regions
34-56 68-89 107-127 147-168 211-231 248-269 289-308
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0017141|Prostaglandin D2 receptor 2 (PTGDR2)
ATGTCGGCCAACGCCACACTGAAGCCACTCTGCCCCATCCTGGAGCAGATGAGCCGTCTC
CAGAGCCACAGCAACACCAGCATCCGCTACATCGACCACGCGGCCGTGCTGCTGCACGGG
CTGGCCTCGCTGCTGGGCCTGGTGGAGAATGGAGTCATCCTCTTCGTGGTGGGCTGCCGC
ATGCGCCAGACCGTGGTCACCACCTGGGTGCTGCACCTGGCGCTGTCCGACCTGTTGGCC
TCTGCTTCCCTGCCCTTCTTCACCTACTTCTTGGCCGTGGGCCACTCGTGGGAGCTGGGC
ACCACCTTCTGCAAACTGCACTCCTCCATCTTCTTTCTCAACATGTTCGCCAGCGGCTTC
CTGCTCAGCGCCATCAGCCTGGACCGCTGCCTGCAGGTGGTGCGGCCGGTGTGGGCGCAG
AACCACCGCACCGTGGCCGCGGCGCACAAAGTCTGCCTGGTGCTTTGGGCACTAGCGGTG
CTCAACACGGTGCCCTATTTCGTGTTCCGGGACACCATCTCGCGGCTGGACGGGCGCATT
ATGTGCTACTACAATGTGCTGCTCCTGAACCCGGGGCCTGACCGCGATGCCACGTGCAAC
TCGCGGCAGGTGGCCCTGGCCGTCAGCAAGTTCCTGCTGGCCTTCCTGGTGCCGCTGGCG
ATCATCGCCTCGAGCCACGCGGCCGTGAGCCTGCGGTTGCAGCACCGCGGCCGCCGGCGG
CCAGGCCGCTTCGTGCGCCTGGTGGCGGCCGTCGTGGCCGCCTTCGCGCTCTGCTGGGGG
CCCTACCACGTGTTCAGCCTGCTGGAGGCGCGGGCGCACGCAAACCCGGGGCTGCGGCCG
CTCGTGTGGCGCGGGCTGCCCTTCGTCACCAGCCTGGCCTTCTTCAACAGCGTGGCCAAC
CCGGTGCTCTACGTGCTCACCTGCCCCGACATGCTGCGCAAGCTGCGGCGCTCGCTGCGC
ACGGTGCTGGAGAGCGTGCTGGTGGACGACAGCGAGCTGGGTGGCGCGGGAAGCAGCCGC
CGCCGCCGCACCTCCTCCACCGCCCGCTCGGCCTCCCCTTTAGCTCTCTGCAGCCGCCCG
GAGGAACCGCGGGGCCCCGCGCGTCTCCTCGGCTGGCTGCTGGGCAGCTGCGCAGCGTCC
CCGCAGACGGGCCCCCTGAACCGGGCGCTGAGCAGCACCTCGAGTTAG
Chromosome Location
11
Locus
11q12-q13.3
External Identifiers
ResourceLink
UniProtKB IDQ9Y5Y4
UniProtKB Entry NamePD2R2_HUMAN
GenBank Protein ID4204216
GenBank Gene IDAB008535
HGNC IDHGNC:4502
General References
  1. Marchese A, Sawzdargo M, Nguyen T, Cheng R, Heng HH, Nowak T, Im DS, Lynch KR, George SR, O'dowd BF: Discovery of three novel orphan G-protein-coupled receptors. Genomics. 1999 Feb 15;56(1):12-21. [PubMed:10036181]
  2. Nagata K, Tanaka K, Ogawa K, Kemmotsu K, Imai T, Yoshie O, Abe H, Tada K, Nakamura M, Sugamura K, Takano S: Selective expression of a novel surface molecule by human Th2 cells in vivo. J Immunol. 1999 Feb 1;162(3):1278-86. [PubMed:9973380]
  3. Taylor TD, Noguchi H, Totoki Y, Toyoda A, Kuroki Y, Dewar K, Lloyd C, Itoh T, Takeda T, Kim DW, She X, Barlow KF, Bloom T, Bruford E, Chang JL, Cuomo CA, Eichler E, FitzGerald MG, Jaffe DB, LaButti K, Nicol R, Park HS, Seaman C, Sougnez C, Yang X, Zimmer AR, Zody MC, Birren BW, Nusbaum C, Fujiyama A, Hattori M, Rogers J, Lander ES, Sakaki Y: Human chromosome 11 DNA sequence and analysis including novel gene identification. Nature. 2006 Mar 23;440(7083):497-500. [PubMed:16554811]
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  5. Monneret G, Gravel S, Diamond M, Rokach J, Powell WS: Prostaglandin D2 is a potent chemoattractant for human eosinophils that acts via a novel DP receptor. Blood. 2001 Sep 15;98(6):1942-8. [PubMed:11535533]
  6. Tsuda H, Michimata T, Sakai M, Nagata K, Nakamura M, Saito S: A novel surface molecule of Th2- and Tc2-type cells, CRTH2 expression on human peripheral and decidual CD4+ and CD8+ T cells during the early stage of pregnancy. Clin Exp Immunol. 2001 Jan;123(1):105-11. [PubMed:11168006]
  7. Hirai H, Tanaka K, Yoshie O, Ogawa K, Kenmotsu K, Takamori Y, Ichimasa M, Sugamura K, Nakamura M, Takano S, Nagata K: Prostaglandin D2 selectively induces chemotaxis in T helper type 2 cells, eosinophils, and basophils via seven-transmembrane receptor CRTH2. J Exp Med. 2001 Jan 15;193(2):255-61. [PubMed:11208866]
  8. Sawyer N, Cauchon E, Chateauneuf A, Cruz RP, Nicholson DW, Metters KM, O'Neill GP, Gervais FG: Molecular pharmacology of the human prostaglandin D2 receptor, CRTH2. Br J Pharmacol. 2002 Dec;137(8):1163-72. [PubMed:12466225]
  9. Xue L, Gyles SL, Barrow A, Pettipher R: Inhibition of PI3K and calcineurin suppresses chemoattractant receptor-homologous molecule expressed on Th2 cells (CRTH2)-dependent responses of Th2 lymphocytes to prostaglandin D(2). Biochem Pharmacol. 2007 Mar 15;73(6):843-53. Epub 2006 Dec 1. [PubMed:17196174]
  10. Gallant MA, Slipetz D, Hamelin E, Rochdi MD, Talbot S, de Brum-Fernandes AJ, Parent JL: Differential regulation of the signaling and trafficking of the two prostaglandin D2 receptors, prostanoid DP receptor and CRTH2. Eur J Pharmacol. 2007 Feb 28;557(2-3):115-23. Epub 2006 Dec 5. [PubMed:17207480]
  11. Roy SJ, Parent A, Gallant MA, de Brum-Fernandes AJ, Stankova J, Parent JL: Characterization of C-terminal tail determinants involved in CRTH2 receptor trafficking: identification of a recycling motif. Eur J Pharmacol. 2010 Mar 25;630(1-3):10-8. doi: 10.1016/j.ejphar.2009.12.022. Epub 2009 Dec 24. [PubMed:20035740]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00328Indometacinapproved, investigationalunknownother/unknownDetails
DB00605Sulindacapproved, investigationalunknownantagonistDetails
DB04828ZomepiracwithdrawnunknownDetails
DB02056Prostaglandin D2investigationalunknownDetails
DB13036RamatrobaninvestigationalunknownDetails
DB01088Iloprostapproved, investigationalunknownagonistDetails
DB00770Alprostadilapproved, investigationalunknownagonistDetails
DB00917DinoprostoneapprovedunknownagonistDetails
DB12789Dinoprostapproved, investigationalunknownagonistDetails