Sodium bicarbonate cotransporter 3

Details

Name
Sodium bicarbonate cotransporter 3
Synonyms
  • Bicarbonate transporter
  • BT
  • Electroneutral Na/HCO(3) cotransporter
  • NBC2
  • NBC2B
  • NBC3
  • NBCn1
  • SBC2
  • SLC4A6
  • Sodium bicarbonate cotransporter 2
  • Sodium bicarbonate cotransporter 2b
  • Solute carrier family 4 member 7
Gene Name
SLC4A7
Organism
Humans
Amino acid sequence
>lcl|BSEQ0009593|Sodium bicarbonate cotransporter 3
MERFRLEKKLPGPDEEAVVDLGKTSSTVNTKFEKEELESHRAVYIGVHVPFSKESRRRHR
HRGHKHHHRRRKDKESDKEDGRESPSYDTPSQRVQFILGTEDDDEEHIPHDLFTEMDELC
YRDGEEYEWKETARWLKFEEDVEDGGDRWSKPYVATLSLHSLFELRSCILNGTVMLDMRA
STLDEIADMVLDNMIASGQLDESIRENVREALLKRHHHQNEKRFTSRIPLVRSFADIGKK
HSDPHLLERNGEGLSASRHSLRTGLSASNLSLRGESPLSLLLGHLLPSSRAGTPAGSRCT
TPVPTPQNSPPSSPSISRLTSRSSQESQRQAPELLVSPASDDIPTVVIHPPEEDLEAALK
GEEQKNEENVDLTPGILASPQSAPGNLDNSKSGEIKGNGSGGSRENSTVDFSKVDMNFMR
KIPTGAEASNVLVGEVDFLERPIIAFVRLAPAVLLTGLTEVPVPTRFLFLLLGPAGKAPQ
YHEIGRSIATLMTDEIFHDVAYKAKDRNDLLSGIDEFLDQVTVLPPGEWDPSIRIEPPKS
VPSQEKRKIPVFHNGSTPTLGETPKEAAHHAGPELQRTGRLFGGLILDIKRKAPFFLSDF
KDALSLQCLASILFLYCACMSPVITFGGLLGEATEGRISAIESLFGASLTGIAYSLFAGQ
PLTILGSTGPVLVFEKILYKFCRDYQLSYLSLRTSIGLWTSFLCIVLVATDASSLVCYIT
RFTEEAFAALICIIFIYEALEKLFDLGETYAFNMHNNLDKLTSYSCVCTEPPNPSNETLA
QWKKDNITAHNISWRNLTVSECKKLRGVFLGSACGHHGPYIPDVLFWCVILFFTTFFLSS
FLKQFKTKRYFPTKVRSTISDFAVFLTIVIMVTIDYLVGVPSPKLHVPEKFEPTHPERGW
IISPLGDNPWWTLLIAAIPALLCTILIFMDQQITAVIINRKEHKLKKGAGYHLDLLMVGV
MLGVCSVMGLPWFVAATVLSISHVNSLKVESECSAPGEQPKFLGIREQRVTGLMIFILMG
LSVFMTSVLKFIPMPVLYGVFLYMGVSSLKGIQLFDRIKLFGMPAKHQPDLIYLRYVPLW
KVHIFTVIQLTCLVLLWVIKVSAAAVVFPMMVLALVFVRKLMDLCFTKRELSWLDDLMPE
SKKKKEDDKKKKEKEEAERMLQDDDDTVHLPFEGGSLLQIPVKALKYSPDKPVSVKISFE
DEPRKKYVDAETSL
Number of residues
1214
Molecular Weight
136042.595
Theoretical pI
Not Available
GO Classification
Functions
inorganic anion exchanger activity / sodium
Processes
anion transmembrane transport / auditory receptor cell development / bicarbonate transport / camera-type eye photoreceptor cell differentiation / cochlear nucleus development / ion transport / regulation of intracellular pH / retina vasculature morphogenesis in camera-type eye / retinal cell programmed cell death / sodium ion transmembrane transport / transmembrane transport / visual perception
Components
apical plasma membrane / basolateral plasma membrane / integral component of membrane / integral component of plasma membrane / plasma membrane / stereocilium
General Function
Sodium:bicarbonate symporter activity
Specific Function
Electroneutral sodium- and bicarbonate-dependent cotransporter with a Na(+):HCO3(-) 1:1 stoichiometry. Regulates intracellular pH and may play a role in bicarbonate salvage in secretory epithelia. May also have an associated sodium channel activity.
Pfam Domain Function
Transmembrane Regions
609-629 638-658 696-716 726-746 818-838 862-882 909-929 955-975 1012-1032 1035-1055 1093-1113
Cellular Location
Basolateral cell membrane
Gene sequence
>lcl|BSEQ0021866|Sodium bicarbonate cotransporter 3 (SLC4A7)
ATGGAGGCTGATGGGGCCGGCGAGCAGATGAGACCGCTACTCACCCGGGGTCCTGATGAA
GAAGCTGTTGTGGATCTTGGCAAAACTAGCTCAACTGTGAACACCAAGTTTGAAAAAGAA
GAACTAGAAAGTCATAGAGCTGTATATATTGGTGTTCACGTCCCGTTTAGTAAAGAGAGT
CGTCGGCGTCATAGGCATCGCGGACACAAACATCACCACCGGAGAAGAAAAGATAAAGAA
TCAGATAAAGAAGATGGACGGGAATCTCCTTCTTATGATACACCATCCCAGAGAGTTCAG
TTTATCCTTGGTACTGAAGATGATGATGAAGAACATATTCCCCATGATCTCTTCACGGAA
ATGGATGAACTGTGTTACAGAGATGGAGAAGAATATGAATGGAAAGAAACTGCTAGATGG
CTGAAATTTGAAGAGGATGTTGAAGATGGCGGTGACCGATGGAGTAAACCTTATGTGGCA
ACTCTCTCTTTGCACAGTCTTTTTGAACTAAGGAGTTGCATCCTCAATGGAACAGTCATG
CTGGATATGAGAGCAAGCACTCTAGATGAAATAGCAGATATGGTATTAGACAACATGATA
GCTTCTGGCCAATTAGACGAGTCCATACGAGAGAATGTCAGAGAAGCTCTTCTGAAGAGA
CATCATCATCAGAATGAGAAAAGATTCACCAGTCGGATTCCTCTTGTTCGATCTTTTGCA
GATATAGGCAAGAAACATTCTGACCCTCACTTGCTTGAAAGGAATGGTATTTTGGCCTCT
CCCCAGTCTGCTCCTGGAAACTTGGACAATAGTAAAAGTGGAGAAATTAAAGGTAATGGA
AGTGGTGGAAGCAGAGAAAATAGTACTGTTGACTTCAGCAAGGTTGATATGAATTTCATG
AGAAAAATTCCTACGGGTGCTGAGGCATCCAACGTCCTGGTGGGCGAAGTAGACTTTTTG
GAAAGGCCAATAATTGCATTTGTGAGACTGGCTCCTGCTGTCCTCCTTACAGGGTTGACT
GAGGTCCCTGTTCCAACCAGGTTTTTGTTTTTGTTATTGGGTCCAGCGGGCAAGGCACCA
CAGTACCATGAAATTGGACGATCAATAGCCACTCTCATGACAGATGAGATTTTCCATGAT
GTAGCTTATAAAGCAAAAGACAGAAATGACCTCTTATCTGGAATTGATGAATTTTTAGAT
CAAGTAACTGTCCTACCTCCAGGAGAGTGGGATCCTTCTATACGCATAGAACCACCAAAA
AGTGTCCCTTCTCAGGAAAAGAGAAAGATTCCTGTGTTTCACAATGGATCTACCCCCACA
CTGGGTGAGACTCCTAAAGAGGCCGCTCATCATGCTGGGCCTGAGCTACAGAGGACTGGA
CGGCTTTTTGGTGGTTTGATACTTGACATCAAAAGGAAAGCACCTTTTTTCTTGAGTGAC
TTCAAGGATGCATTAAGCCTGCAGTGCCTGGCCTCGATTCTTTTCCTATACTGTGCCTGT
ATGTCTCCTGTAATCACTTTTGGAGGGCTGCTTGGAGAAGCTACAGAAGGCAGAATAAGT
GCAATAGAGTCTCTTTTTGGAGCATCATTAACTGGGATTGCCTATTCATTGTTTGCTGGG
CAACCTCTAACAATATTGGGGAGCACAGGTCCAGTTCTAGTGTTTGAAAAAATTTTATAT
AAATTCTGCAGAGATTATCAACTTTCTTATCTGTCTTTAAGAACCAGTATTGGTCTGTGG
ACTTCTTTTTTGTGCATTGTTTTGGTTGCAACAGATGCAAGCAGCCTTGTGTGTTATATT
ACTCGATTTACAGAAGAGGCTTTTGCAGCCCTTATTTGCATCATATTCATCTACGAGGCT
TTGGAGAAGCTCTTTGATTTAGGAGAAACATATGCATTTAATATGCACAACAACTTAGAT
AAACTGACCAGCTACTCATGTGTATGTACTGAACCTCCAAACCCCAGCAATGAAACTCTA
GCACAATGGAAGAAAGATAATATAACAGCACACAATATTTCCTGGAGAAATCTTACTGTT
TCTGAATGTAAAAAACTTCGTGGTGTATTCTTGGGGTCAGCTTGTGGTCATCATGGACCT
TATATTCCAGATGTGCTCTTTTGGTGTGTCATCTTGTTTTTCACAACATTTTTTCTGTCT
TCATTCCTCAAGCAATTTAAGACCAAGCGTTACTTTCCTACCAAGGTGCGATCGACAATC
AGTGATTTTGCTGTATTTCTCACAATAGTAATAATGGTTACAATTGACTACCTTGTAGGA
GTTCCATCTCCTAAACTTCATGTTCCTGAAAAATTTGAGCCTACTCATCCAGAGAGAGGG
TGGATCATAAGCCCACTGGGAGATAATCCTTGGTGGACCTTATTAATAGCTGCTATTCCT
GCTTTGCTTTGTACCATTCTCATCTTTATGGATCAACAAATCACAGCTGTAATTATAAAC
AGAAAGGAACACAAATTGAAGAAAGGAGCTGGCTATCACCTTGATTTGCTCATGGTTGGC
GTTATGTTGGGAGTTTGCTCTGTCATGGGACTTCCATGGTTTGTGGCTGCAACAGTGTTG
TCAATAAGTCATGTCAACAGCTTAAAAGTTGAATCTGAATGTTCTGCTCCAGGGGAACAA
CCCAAGTTTTTGGGAATTCGTGAACAGCGGGTTACAGGGCTAATGATTTTTATTCTAATG
GGCCTCTCTGTGTTCATGACTTCAGTCCTAAAGTTTATTCCAATGCCTGTTCTGTATGGT
GTTTTCCTTTATATGGGAGTTTCCTCATTAAAAGGAATCCAGTTATTTGACCGTATAAAA
TTATTTGGAATGCCTGCTAAGCATCAGCCTGATTTGATATACCTCCGTTATGTGCCGCTC
TGGAAGGTCCATATTTTCACAGTCATTCAGCTTACTTGTTTGGTCCTTTTATGGGTGATA
AAAGTTTCAGCTGCTGCAGTGGTTTTTCCCATGATGGTTCTTGCATTAGTGTTTGTGCGC
AAACTCATGGACCTGTGTTTCACGAAGAGAGAACTTAGTTGGCTTGATGATCTTATGCCA
GAAAGTAAGAAAAAGAAAGAAGATGACAAAAAGAAAAAAGAGAAAGAGGAAGCTGAACGG
ATGCTTCAAGATGATGATGATACTGTGCACCTTCCATTTGAAGGGGGAAGTCTCTTGCAA
ATTCCAGTCAAGGCCCTAAAATATAGTGTTGATCCCTCAATTGTTAACATATCAGATGAA
ATGGCCAAAACTGCACAGTGGAAGGCACTTTCCATGAATACTGAGAATGCCAAAGTAACC
AGATCTAACATGAGTCCTGATAAACCTGTGAGTGTGAAAATAAGTTTTGAAGATGAACCA
AGAAAGAAATACGTGGATGCTGAAACTTCATTATAG
Chromosome Location
3
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDQ9Y6M7
UniProtKB Entry NameS4A7_HUMAN
HGNC IDHGNC:11033
General References
  1. Ishibashi K, Sasaki S, Marumo F: Molecular cloning of a new sodium bicarbonate cotransporter cDNA from human retina. Biochem Biophys Res Commun. 1998 May 19;246(2):535-8. [PubMed:9610397]
  2. Pushkin A, Abuladze N, Lee I, Newman D, Hwang J, Kurtz I: Cloning, tissue distribution, genomic organization, and functional characterization of NBC3, a new member of the sodium bicarbonate cotransporter family. J Biol Chem. 1999 Jun 4;274(23):16569-75. [PubMed:10347222]
  3. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005]
  4. Muzny DM, Scherer SE, Kaul R, Wang J, Yu J, Sudbrak R, Buhay CJ, Chen R, Cree A, Ding Y, Dugan-Rocha S, Gill R, Gunaratne P, Harris RA, Hawes AC, Hernandez J, Hodgson AV, Hume J, Jackson A, Khan ZM, Kovar-Smith C, Lewis LR, Lozado RJ, Metzker ML, Milosavljevic A, Miner GR, Morgan MB, Nazareth LV, Scott G, Sodergren E, Song XZ, Steffen D, Wei S, Wheeler DA, Wright MW, Worley KC, Yuan Y, Zhang Z, Adams CQ, Ansari-Lari MA, Ayele M, Brown MJ, Chen G, Chen Z, Clendenning J, Clerc-Blankenburg KP, Chen R, Chen Z, Davis C, Delgado O, Dinh HH, Dong W, Draper H, Ernst S, Fu G, Gonzalez-Garay ML, Garcia DK, Gillett W, Gu J, Hao B, Haugen E, Havlak P, He X, Hennig S, Hu S, Huang W, Jackson LR, Jacob LS, Kelly SH, Kube M, Levy R, Li Z, Liu B, Liu J, Liu W, Lu J, Maheshwari M, Nguyen BV, Okwuonu GO, Palmeiri A, Pasternak S, Perez LM, Phelps KA, Plopper FJ, Qiang B, Raymond C, Rodriguez R, Saenphimmachak C, Santibanez J, Shen H, Shen Y, Subramanian S, Tabor PE, Verduzco D, Waldron L, Wang J, Wang J, Wang Q, Williams GA, Wong GK, Yao Z, Zhang J, Zhang X, Zhao G, Zhou J, Zhou Y, Nelson D, Lehrach H, Reinhardt R, Naylor SL, Yang H, Olson M, Weinstock G, Gibbs RA: The DNA sequence, annotation and analysis of human chromosome 3. Nature. 2006 Apr 27;440(7088):1194-8. [PubMed:16641997]
  5. Park M, Ko SB, Choi JY, Muallem G, Thomas PJ, Pushkin A, Lee MS, Kim JY, Lee MG, Muallem S, Kurtz I: The cystic fibrosis transmembrane conductance regulator interacts with and regulates the activity of the HCO3- salvage transporter human Na+-HCO3- cotransport isoform 3. J Biol Chem. 2002 Dec 27;277(52):50503-9. Epub 2002 Oct 25. [PubMed:12403779]
  6. Pushkin A, Abuladze N, Newman D, Muronets V, Sassani P, Tatishchev S, Kurtz I: The COOH termini of NBC3 and the 56-kDa H+-ATPase subunit are PDZ motifs involved in their interaction. Am J Physiol Cell Physiol. 2003 Mar;284(3):C667-73. Epub 2002 Nov 20. [PubMed:12444018]
  7. Loiselle FB, Morgan PE, Alvarez BV, Casey JR: Regulation of the human NBC3 Na+/HCO3- cotransporter by carbonic anhydrase II and PKA. Am J Physiol Cell Physiol. 2004 Jun;286(6):C1423-33. Epub 2004 Jan 21. [PubMed:14736710]
  8. Brill LM, Salomon AR, Ficarro SB, Mukherji M, Stettler-Gill M, Peters EC: Robust phosphoproteomic profiling of tyrosine phosphorylation sites from human T cells using immobilized metal affinity chromatography and tandem mass spectrometry. Anal Chem. 2004 May 15;76(10):2763-72. [PubMed:15144186]
  9. Reiners J, van Wijk E, Marker T, Zimmermann U, Jurgens K, te Brinke H, Overlack N, Roepman R, Knipper M, Kremer H, Wolfrum U: Scaffold protein harmonin (USH1C) provides molecular links between Usher syndrome type 1 and type 2. Hum Mol Genet. 2005 Dec 15;14(24):3933-43. Epub 2005 Nov 21. [PubMed:16301216]
  10. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983]
  11. Cantin GT, Yi W, Lu B, Park SK, Xu T, Lee JD, Yates JR 3rd: Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis. J Proteome Res. 2008 Mar;7(3):1346-51. doi: 10.1021/pr0705441. Epub 2008 Jan 26. [PubMed:18220336]
  12. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648]
  13. Boron WF, Chen L, Parker MD: Modular structure of sodium-coupled bicarbonate transporters. J Exp Biol. 2009 Jun;212(Pt 11):1697-706. doi: 10.1242/jeb.028563. [PubMed:19448079]
  14. Wollscheid B, Bausch-Fluck D, Henderson C, O'Brien R, Bibel M, Schiess R, Aebersold R, Watts JD: Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins. Nat Biotechnol. 2009 Apr;27(4):378-86. doi: 10.1038/nbt.1532. Epub 2009 Apr 6. [PubMed:19349973]
  15. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332]
  16. Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M: Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis. Sci Signal. 2010 Jan 12;3(104):ra3. doi: 10.1126/scisignal.2000475. [PubMed:20068231]
  17. Rigbolt KT, Prokhorova TA, Akimov V, Henningsen J, Johansen PT, Kratchmarova I, Kassem M, Mann M, Olsen JV, Blagoev B: System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation. Sci Signal. 2011 Mar 15;4(164):rs3. doi: 10.1126/scisignal.2001570. [PubMed:21406692]
  18. Vaca Jacome AS, Rabilloud T, Schaeffer-Reiss C, Rompais M, Ayoub D, Lane L, Bairoch A, Van Dorsselaer A, Carapito C: N-terminome analysis of the human mitochondrial proteome. Proteomics. 2015 Jul;15(14):2519-24. doi: 10.1002/pmic.201400617. Epub 2015 Jun 8. [PubMed:25944712]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB01390Sodium bicarbonateapprovedunknownsubstrateDetails