Iron ABC transporter substrate-binding protein

Details

Name
Iron ABC transporter substrate-binding protein
Synonyms
  • Iron binding protein FbpA
  • Periplasmic iron binding protein A FbpA
Gene Name
fbpA
Organism
Mannheimia haemolytica
Amino acid sequence
>lcl|BSEQ0016855|Iron ABC transporter substrate-binding protein
MKKTLSALAIAAATFTSTSTLAANEVNVYSYRQPYLIEPMLKNFEKDTGIKVNIIFADKG
LVDRVKQEGELSPADVLLTVDISRVMEIVNADLAQKIDSKVLEKNIPAQFRDSNDQWFGL
TTRARVIYTSKDRVGKLPAGFDYLDLAKPEYKGKVCVRSGKNSYNVSLFAAMIEHYGIEK
TKAFLEGLKANLARKPQGGDRDQVKAIKEGICDYSIGNSYYYGKMLDDEKQKSWAEAAII
NFPSGEHGTHKNISGVVIAKHSPNKANAVKLIEYLSGEKAQGLYAELNHEYPVKEGIEPS
AIVKGWGTFKSDTIKLEDIAKNYEAALKLVDEVKFDDFSEKK
Number of residues
342
Molecular Weight
38023.085
Theoretical pI
8.51
GO Classification
Functions
metal ion binding
General Function
Metal ion binding
Specific Function
Not Available
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Not Available
Gene sequence
>lcl|BSEQ0016856|Iron ABC transporter substrate-binding protein (fbpA)
ATGAAAAAAACACTTTCTGCACTTGCTATTGCTGCAGCCACTTTTACATCAACTTCAACG
CTTGCTGCAAATGAAGTGAATGTTTATTCTTACCGCCAGCCTTACTTAATTGAGCCAATG
CTAAAAAACTTTGAAAAAGATACTGGCATTAAAGTAAACATCATCTTCGCTGATAAAGGG
TTGGTTGATCGTGTAAAACAAGAAGGTGAATTAAGTCCTGCTGATGTGCTTTTAACAGTA
GATATTTCACGCGTAATGGAAATTGTTAACGCTGATCTTGCACAAAAAATTGACTCTAAA
GTGTTAGAAAAAAATATTCCTGCACAATTCCGTGACTCTAACGACCAATGGTTTGGTTTA
ACCACACGTGCTCGTGTTATCTACACGTCAAAAGATCGTGTAGGTAAATTACCAGCAGGC
TTTGACTACCTAGATTTAGCTAAACCAGAGTATAAAGGTAAAGTCTGCGTGCGTTCAGGC
AAAAACTCTTACAATGTCTCACTATTCGCGGCGATGATCGAACATTACGGCATTGAAAAA
ACCAAAGCATTCTTAGAAGGCTTAAAAGCGAACTTAGCACGAAAACCACAAGGTGGTGAC
CGTGATCAAGTAAAAGCAATTAAAGAAGGCATCTGTGATTACTCTATCGGTAACAGCTAC
TACTACGGCAAAATGTTAGATGATGAGAAACAAAAATCGTGGGCTGAAGCAGCGATTATT
AATTTCCCGAGTGGTGAACACGGCACGCACAAAAACATCAGCGGCGTAGTTATTGCAAAA
CACTCACCAAATAAAGCAAACGCGGTGAAATTAATTGAATACCTAAGTGGCGAAAAAGCA
CAAGGTTTATATGCTGAACTTAACCACGAATATCCAGTAAAAGAAGGCATCGAGCCATCA
GCAATCGTAAAAGGTTGGGGTACGTTCAAATCAGATACCATCAAACTTGAAGATATCGCA
AAAAATTACGAAGCCGCATTAAAATTAGTTGATGAAGTGAAATTTGACGATTTCTCTGAG
AAAAAATAA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDQ9Z4N6
UniProtKB Entry NameQ9Z4N6_MANHA
GenBank Gene IDAF047427
General References
  1. Shouldice SR, Dougan DR, Williams PA, Skene RJ, Snell G, Scheibe D, Kirby S, Hosfield DJ, McRee DE, Schryvers AB, Tari LW: Crystal structure of Pasteurella haemolytica ferric ion-binding protein A reveals a novel class of bacterial iron-binding proteins. J Biol Chem. 2003 Oct 17;278(42):41093-8. Epub 2003 Jul 25. [PubMed:12882966]
  2. Shouldice SR, Skene RJ, Dougan DR, Snell G, McRee DE, Schryvers AB, Tari LW: Structural basis for iron binding and release by a novel class of periplasmic iron-binding proteins found in gram-negative pathogens. J Bacteriol. 2004 Jun;186(12):3903-10. [PubMed:15175304]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB01942Formic acidexperimental, investigationalunknownDetails
DB13257Ferrous sulfate anhydrousapprovedyestransporterDetails