Amylosucrase

Details

Name
Amylosucrase
Synonyms
  • 2.4.1.4
Gene Name
ams
Organism
Neisseria polysaccharea
Amino acid sequence
>lcl|BSEQ0016901|Amylosucrase
MLTPTQQVGLILQYLKTRILDIYTPEQRAGIEKSEDWRQFSRRMDTHFPKLMNELDSVYG
NNEALLPMLEMLLAQAWQSYSQRNSSLKDIDIARENNPDWILSNKQVGGVCYVDLFAGDL
KGLKDKIPYFQELGLTYLHLMPLFKCPEGKSDGGYAVSSYRDVNPALGTIGDLREVIAAL
HEAGISAVVDFIFNHTSNEHEWAQRCAAGDPLFDNFYYIFPDRRMPDQYDRTLREIFPDQ
HPGGFSQLEDGRWVWTTFNSFQWDLNYSNPWVFRAMAGEMLFLANLGVDILRMDAVAFIW
KQMGTSCENLPQAHALIRAFNAVMRIAAPAVFFKSEAIVHPDQVVQYIGQDECQIGYNPL
QMALLWNTLATREVNLLHQALTYRHNLPEHTAWVNYVRSHDDIGWTFADEDAAYLGISGY
DHRQFLNRFFVNRFDGSFARGVPFQYNPSTGDCRVSGTAAALVGLAQDDPHAVDRIKLLY
SIALSTGGLPLIYLGDEVGTLNDDDWSQDSNKSDDSRWAHRPRYNEALYAQRNDPSTAAG
QIYQGLRHMIAVRQSNPRFDGGRLVTFNTNNKHIIGYIRNNALLAFGNFSEYPQTVTAHT
LQAMPFKAHDLIGGKTVSLNQDLTLQPYQVMWLEIA
Number of residues
636
Molecular Weight
72343.005
Theoretical pI
5.55
GO Classification
Functions
amylosucrase activity / cation binding
Processes
carbohydrate metabolic process
Components
extracellular region
General Function
Cation binding
Specific Function
Catalyzes the synthesis of alpha-glucan from sucrose. Catalyzes, in addition, sucrose hydrolysis, maltose and maltotriose synthesis by successive transfers of the glucosyl moiety of sucrose onto the released glucose, and finally turanose and trehalulose synthesis, these two sucrose isomers being obtained by glucosyl transfer onto fructose.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Secreted
Gene sequence
>lcl|BSEQ0005542|1911 bp
ATGTTGACCCCCACGCAGCAAGTCGGTTTGATTTTACAGTACCTCAAAACACGCATCTTG
GACATCTACACGCCCGAACAGCGCGCCGGCATCGAAAAATCCGAAGACTGGCGGCAGTTT
TCGCGCCGCATGGATACGCATTTCCCCAAACTGATGAACGAACTCGACAGCGTGTACGGC
AACAACGAAGCCCTGCTGCCTATGCTGGAAATGCTGCTGGCGCAGGCATGGCAAAGCTAT
TCCCAACGCAACTCATCCTTAAAAGATATCGATATCGCGCGCGAAAACAACCCCGATTGG
ATTTTGTCCAACAAACAAGTCGGCGGCGTGTGCTACGTTGATTTGTTTGCCGGCGATTTG
AAGGGCTTGAAAGATAAAATTCCTTATTTTCAAGAGCTTGGTTTGACTTATCTGCACCTG
ATGCCGCTGTTTAAATGCCCTGAAGGCAAAAGCGACGGCGGCTATGCGGTCAGCAGCTAC
CGCGATGTCAATCCGGCACTGGGCACAATAGGCGACTTGCGCGAAGTCATTGCTGCGCTG
CACGAAGCCGGCATTTCCGCCGTCGTCGATTTTATCTTCAACCACACCTCCAACGAACAC
GAATGGGCGCAACGCTGCGCCGCCGGCGACCCGCTTTTCGACAATTTCTACTATATTTTC
CCCGACCGCCGGATGCCCGACCAATACGACCGCACCCTGCGCGAAATCTTCCCCGACCAG
CACCCGGGCGGCTTCTCGCAACTGGAAGACGGACGCTGGGTGTGGACGACCTTCAATTCC
TTCCAATGGGACTTGAATTACAGCAACCCGTGGGTATTCCGCGCAATGGCGGGCGAAATG
CTGTTCCTTGCCAACTTGGGCGTTGACATCCTGCGTATGGATGCGGTTGCCTTTATTTGG
AAACAAATGGGGACAAGCTGCGAAAACCTGCCGCAGGCGCACGCCCTCATCCGCGCGTTC
AATGCCGTTATGCGTATTGCCGCGCCCGCCGTGTTCTTCAAATCCGAAGCCATCGTCCAC
CCCGACCAAGTCGTCCAATACATCGGGCAGGACGAATGCCAAATCGGTTACAACCCCCTG
CAAATGGCATTGTTGTGGAACACCCTTGCCACGCGCGAAGTCAACCTGCTCCATCAGGCG
CTGACCTACCGCCACAACCTGCCCGAGCATACCGCCTGGGTCAACTACGTCCGCAGCCAC
GACGACATCGGCTGGACGTTTGCCGATGAAGACGCGGCATATCTGGGCATAAGCGGCTAC
GACCACCGCCAATTCCTCAACCGCTTCTTCGTCAACCGTTTCGACGGCAGCTTCGCTCGT
GGCGTACCGTTCCAATACAACCCAAGCACAGGCGACTGCCGTGTCAGTGGTACAGCCGCG
GCATTGGTCGGCTTGGCGCAAGACGATCCCCACGCCGTTGACCGCATCAAACTCTTGTAC
AGCATTGCTTTGAGTACCGGCGGTCTGCCGCTGATTTACCTAGGCGACGAAGTGGGTACG
CTCAATGACGACGACTGGTCGCAAGACAGCAATAAGAGCGACGACAGCCGTTGGGCGCAC
CGTCCGCGCTACAACGAAGCCCTGTACGCGCAACGCAACGATCCGTCGACCGCAGCCGGG
CAAATCTATCAGGGCTTGCGCCATATGATTGCCGTCCGCCAAAGCAATCCGCGCTTCGAC
GGCGGCAGGCTGGTTACATTCAACACCAACAACAAGCACATCATCGGCTACATCCGCAAC
AATGCGCTTTTGGCATTCGGTAACTTCAGCGAATATCCGCAAACCGTTACCGCGCATACC
CTGCAAGCCATGCCCTTCAAGGCGCACGACCTCATCGGTGGCAAAACTGTCAGCCTGAAT
CAGGATTTGACGCTTCAGCCCTATCAGGTCATGTGGCTCGAAATCGCCTGA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDQ9ZEU2
UniProtKB Entry NameAMYS_NEIPO
GenBank Gene IDAJ011781
General References
  1. Buttcher V, Welsh T, Willmitzer L, Kossmann J: Cloning and characterization of the gene for amylosucrase from Neisseria polysaccharea: production of a linear alpha-1,4-glucan. J Bacteriol. 1997 May;179(10):3324-30. [PubMed:9150231]
  2. De Montalk GP, Remaud-Simeon M, Willemot RM, Planchot V, Monsan P: Sequence analysis of the gene encoding amylosucrase from Neisseria polysaccharea and characterization of the recombinant enzyme. J Bacteriol. 1999 Jan;181(2):375-81. [PubMed:9882648]
  3. Zhu P, Tsang RS, Tsai CM: Nonencapsulated Neisseria meningitidis strain produces amylopectin from sucrose: altering the concept for differentiation between N. meningitidis and N. polysaccharea. J Clin Microbiol. 2003 Jan;41(1):273-8. [PubMed:12517860]
  4. Potocki de Montalk G, Remaud-Simeon M, Willemot RM, Sarcabal P, Planchot V, Monsan P: Amylosucrase from Neisseria polysaccharea: novel catalytic properties. FEBS Lett. 2000 Apr 14;471(2-3):219-23. [PubMed:10767427]
  5. Sarcabal P, Remaud-Simeon M, Willemot R, Potocki de Montalk G, Svensson B, Monsan P: Identification of key amino acid residues in Neisseria polysaccharea amylosucrase. FEBS Lett. 2000 May 26;474(1):33-7. [PubMed:10828446]
  6. Mirza O, Skov LK, Remaud-Simeon M, Potocki de Montalk G, Albenne C, Monsan P, Gajhede M: Crystal structures of amylosucrase from Neisseria polysaccharea in complex with D-glucose and the active site mutant Glu328Gln in complex with the natural substrate sucrose. Biochemistry. 2001 Jul 31;40(30):9032-9. [PubMed:11467966]
  7. Skov LK, Mirza O, Henriksen A, De Montalk GP, Remaud-Simeon M, Sarcabal P, Willemot RM, Monsan P, Gajhede M: Amylosucrase, a glucan-synthesizing enzyme from the alpha-amylase family. J Biol Chem. 2001 Jul 6;276(27):25273-8. Epub 2001 Apr 16. [PubMed:11306569]
  8. Skov LK, Mirza O, Sprogoe D, Dar I, Remaud-Simeon M, Albenne C, Monsan P, Gajhede M: Oligosaccharide and sucrose complexes of amylosucrase. Structural implications for the polymerase activity. J Biol Chem. 2002 Dec 6;277(49):47741-7. Epub 2002 Oct 2. [PubMed:12364331]
  9. Jensen MH, Mirza O, Albenne C, Remaud-Simeon M, Monsan P, Gajhede M, Skov LK: Crystal structure of the covalent intermediate of amylosucrase from Neisseria polysaccharea. Biochemistry. 2004 Mar 23;43(11):3104-10. [PubMed:15023061]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB02772Sucroseapproved, experimental, investigationalunknownDetails
DB02379Beta-D-GlucoseexperimentalunknownDetails
DB044471,4-DithiothreitolexperimentalunknownDetails