Flavodoxin

Details

Name
Flavodoxin
Synonyms
Not Available
Gene Name
fldA
Organism
Helicobacter pylori (strain J99 / ATCC 700824)
Amino acid sequence
>lcl|BSEQ0012123|Flavodoxin
MGKIGIFFGTDSGNAEAIAEKISKAIGNAEVIDVAKASKEQFNGFTKVILVAPTAGAGDL
QTDWEDFLGTLEASDFANKTIGLVGLGDQDTYSETFAEGIFHIYEKAKAGKVVGQTPTDG
YHFEASKAVEGGKFVGLVIDEDNQDDLTDERIAKWVEQVKGSFA
Number of residues
164
Molecular Weight
17473.305
Theoretical pI
4.2
GO Classification
Functions
FMN binding
Processes
oxidation-reduction process
General Function
Fmn binding
Specific Function
Low-potential electron donor to a number of redox enzymes.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Not Available
Gene sequence
>lcl|BSEQ0012124|Flavodoxin (fldA)
ATGGGAAAAATTGGTATCTTTTTTGGGACAGACAGCGGGAACGCTGAAGCTATCGCTGAA
AAAATCAGCAAGGCTATTGGTAATGCTGAAGTGATTGATGTGGCTAAAGCTTCTAAAGAG
CAATTTAATGGCTTTACAAAGGTTATTTTAGTCGCTCCAACAGCCGGTGCGGGCGATTTG
CAAACAGATTGGGAAGACTTTTTAGGCACACTAGAAGCGAGCGACTTTGCGAATAAAACC
ATTGGGCTTGTAGGCTTGGGCGATCAAGACACTTACAGCGAAACTTTCGCGGAAGGCATT
TTCCACATTTATGAAAAAGCTAAAGCCGGCAAAGTGGTAGGACAAACTCCCACTGATGGT
TATCATTTTGAAGCTTCTAAAGCGGTAGAAGGCGGTAAATTCGTGGGTCTAGTGATTGAT
GAAGACAATCAAGACGATTTGACAGATGAAAGAATTGCAAAATGGGTAGAACAAGTTAAA
GGTTCTTTCGCTTAA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDQ9ZK53
UniProtKB Entry NameFLAV_HELPJ
GenBank Gene IDAE001439
General References
  1. Alm RA, Ling LS, Moir DT, King BL, Brown ED, Doig PC, Smith DR, Noonan B, Guild BC, deJonge BL, Carmel G, Tummino PJ, Caruso A, Uria-Nickelsen M, Mills DM, Ives C, Gibson R, Merberg D, Mills SD, Jiang Q, Taylor DE, Vovis GF, Trust TJ: Genomic-sequence comparison of two unrelated isolates of the human gastric pathogen Helicobacter pylori. Nature. 1999 Jan 14;397(6715):176-80. [PubMed:9923682]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB03247Flavin mononucleotideapproved, investigationalunknownDetails