Chymase
Details
- Name
- Chymase
- Synonyms
- 3.4.21.39
- Alpha-chymase
- CYH
- CYM
- Mast cell protease I
- Gene Name
- CMA1
- Organism
- Humans
- Amino acid sequence
>lcl|BSEQ0002067|Chymase MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNF VLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKA SLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRD FDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWI NQILQAN
- Number of residues
- 247
- Molecular Weight
- 27324.56
- Theoretical pI
- 9.71
- GO Classification
- Functionspeptide binding / serine-type endopeptidase activity / serine-type peptidase activityProcessesangiotensin maturation / cellular protein metabolic process / cellular response to glucose stimulus / extracellular matrix disassembly / extracellular matrix organization / interleukin-1 beta biosynthetic process / midbrain development / positive regulation of angiogenesis / protein processing / regulation of inflammatory responseComponentsextracellular region / extracellular space / intracellular
- General Function
- Serine-type peptidase activity
- Specific Function
- Major secreted protease of mast cells with suspected roles in vasoactive peptide generation, extracellular matrix degradation, and regulation of gland secretion.
- Pfam Domain Function
- Trypsin (PF00089)
- Transmembrane Regions
- Not Available
- Cellular Location
- Secreted
- Gene sequence
>lcl|BSEQ0010726|Chymase (CMA1) ATGTTACTAAAGTTGAAGGAGAAAGCCAGCCTGACCCTGGCTGTGGGGACACTCCCCTTC CCATCCCAATTCAACTTTGTCCCACCTGGGAGAATGTGCCGGGTGGCTGGCTGGGGAAGA ACAGGTGTGTTGAAGCCGGGCTCAGACACTCTGCAAGAGGTGAAGCTGAGACTCATGGAT CCCCAGGCCTGCAGCCACTTCAGAGACTTTGACCACAATCTTCAGCTGTGTGTGGGCAAT CCCAGGAAGACAAAATCTGCATTTAAGGGAGACTCTGGGGGCCCTCTTCTGTGTGCTGGG GTGGCCCAGGGCATCGTATCCTATGGACGGTCGGATGCAAAGCCCCCTGCTGTCTTCACC CGAATCTCCCATTACCGGCCCTGGATCAACCAGATCCTGCAGGCAAATTAA
- Chromosome Location
- 14
- Locus
- 14q11.2
- External Identifiers
Resource Link UniProtKB ID P23946 UniProtKB Entry Name CMA1_HUMAN GenBank Protein ID 180542 GenBank Gene ID M64269 GenAtlas ID CMA1 HGNC ID HGNC:2097 - General References
- Caughey GH, Zerweck EH, Vanderslice P: Structure, chromosomal assignment, and deduced amino acid sequence of a human gene for mast cell chymase. J Biol Chem. 1991 Jul 15;266(20):12956-63. [Article]
- Urata H, Kinoshita A, Perez DM, Misono KS, Bumpus FM, Graham RM, Husain A: Cloning of the gene and cDNA for human heart chymase. J Biol Chem. 1991 Sep 15;266(26):17173-9. [Article]
- Schechter NM, Wang ZM, Blacher RW, Lessin SR, Lazarus GS, Rubin H: Determination of the primary structures of human skin chymase and cathepsin G from cutaneous mast cells of urticaria pigmentosa lesions. J Immunol. 1994 Apr 15;152(8):4062-9. [Article]
- Goshima N, Kawamura Y, Fukumoto A, Miura A, Honma R, Satoh R, Wakamatsu A, Yamamoto J, Kimura K, Nishikawa T, Andoh T, Iida Y, Ishikawa K, Ito E, Kagawa N, Kaminaga C, Kanehori K, Kawakami B, Kenmochi K, Kimura R, Kobayashi M, Kuroita T, Kuwayama H, Maruyama Y, Matsuo K, Minami K, Mitsubori M, Mori M, Morishita R, Murase A, Nishikawa A, Nishikawa S, Okamoto T, Sakagami N, Sakamoto Y, Sasaki Y, Seki T, Sono S, Sugiyama A, Sumiya T, Takayama T, Takayama Y, Takeda H, Togashi T, Yahata K, Yamada H, Yanagisawa Y, Endo Y, Imamoto F, Kisu Y, Tanaka S, Isogai T, Imai J, Watanabe S, Nomura N: Human protein factory for converting the transcriptome into an in vitro-expressed proteome,. Nat Methods. 2008 Dec;5(12):1011-7. [Article]
- Heilig R, Eckenberg R, Petit JL, Fonknechten N, Da Silva C, Cattolico L, Levy M, Barbe V, de Berardinis V, Ureta-Vidal A, Pelletier E, Vico V, Anthouard V, Rowen L, Madan A, Qin S, Sun H, Du H, Pepin K, Artiguenave F, Robert C, Cruaud C, Bruls T, Jaillon O, Friedlander L, Samson G, Brottier P, Cure S, Segurens B, Aniere F, Samain S, Crespeau H, Abbasi N, Aiach N, Boscus D, Dickhoff R, Dors M, Dubois I, Friedman C, Gouyvenoux M, James R, Madan A, Mairey-Estrada B, Mangenot S, Martins N, Menard M, Oztas S, Ratcliffe A, Shaffer T, Trask B, Vacherie B, Bellemere C, Belser C, Besnard-Gonnet M, Bartol-Mavel D, Boutard M, Briez-Silla S, Combette S, Dufosse-Laurent V, Ferron C, Lechaplais C, Louesse C, Muselet D, Magdelenat G, Pateau E, Petit E, Sirvain-Trukniewicz P, Trybou A, Vega-Czarny N, Bataille E, Bluet E, Bordelais I, Dubois M, Dumont C, Guerin T, Haffray S, Hammadi R, Muanga J, Pellouin V, Robert D, Wunderle E, Gauguet G, Roy A, Sainte-Marthe L, Verdier J, Verdier-Discala C, Hillier L, Fulton L, McPherson J, Matsuda F, Wilson R, Scarpelli C, Gyapay G, Wincker P, Saurin W, Quetier F, Waterston R, Hood L, Weissenbach J: The DNA sequence and analysis of human chromosome 14. Nature. 2003 Feb 6;421(6923):601-7. Epub 2003 Jan 1. [Article]
- Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
- Sukenaga Y, Kido H, Neki A, Enomoto M, Ishida K, Takagi K, Katunuma N: Purification and molecular cloning of chymase from human tonsils. FEBS Lett. 1993 May 24;323(1-2):119-22. [Article]
- Jenne DE, Tschopp J: Angiotensin II-forming heart chymase is a mast-cell-specific enzyme. Biochem J. 1991 Jun 1;276 ( Pt 2):567-8. [Article]
- Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res. 2009 Feb;8(2):651-61. doi: 10.1021/pr8008012. [Article]
- McGrath ME, Mirzadegan T, Schmidt BF: Crystal structure of phenylmethanesulfonyl fluoride-treated human chymase at 1.9 A. Biochemistry. 1997 Nov 25;36(47):14318-24. [Article]
- Pereira PJ, Wang ZM, Rubin H, Huber R, Bode W, Schechter NM, Strobl S: The 2.2 A crystal structure of human chymase in complex with succinyl-Ala-Ala-Pro-Phe-chloromethylketone: structural explanation for its dipeptidyl carboxypeptidase specificity. J Mol Biol. 1999 Feb 12;286(1):163-73. [Article]
- Pereira PJ, Wang ZM, Rubin H, Huber R, Bode W, Schechter NM, Strobl S: The 2.2 A Crystal Structure of Human Chymase in Complex with Succinyl-Ala-Ala-Pro-Phe-chloromethylketone: Structural Explanation for its Dipeptidyl Carboxypeptidase Specificity. J Mol Biol. 1999 Apr 9;286(4):817. [Article]
Drug Relations
- Drug Relations
DrugBank ID Name Drug group Pharmacological action? Actions Details DB03297 Benzylsulfonic acid experimental unknown Details DB03814 2-(N-morpholino)ethanesulfonic acid experimental unknown Details DB04016 2-[3-({Methyl[1-(2-Naphthoyl)Piperidin-4-Yl]Amino}Carbonyl)-2-Naphthyl]-1-(1-Naphthyl)-2-Oxoethylphosphonic Acid experimental unknown Details DB07680 [(1S)-1-(5-CHLORO-1-BENZOTHIEN-3-YL)-2-(2-NAPHTHYLAMINO)-2-OXOETHYL]PHOSPHONIC ACID experimental unknown Details