2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase

Details

Name
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Synonyms
  • 2.7.6.3
  • 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase
  • 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase
  • HPPK
  • PPPK
Gene Name
folK
Organism
Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Amino acid sequence
>lcl|BSEQ0051181|2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
MTRVVLSVGSNLGDRLARLRSVADGLGDALIAASPIYEADPWGGVEQGQFLNAVLIADDP
TCEPREWLRRAQEFERAAGRVRGQRWGPRNLDVDLIACYQTSATEALVEVTARENHLTLP
HPLAHLRAFVLIPWIAVDPTAQLTVAGCPRPVTRLLAELEPADRDSVRLFRPSFDLNSRH
PVSRAPES
Number of residues
188
Molecular Weight
20731.305
Theoretical pI
Not Available
GO Classification
Functions
ATP binding / kinase activity / 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase activity
Processes
folic acid biosynthetic process / tetrahydrofolate biosynthetic process
General Function
Not Available
Specific Function
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase activity
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Not Available
Gene sequence
>lcl|BSEQ0051182|2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (folK)
ATGACGCGGGTAGTGCTCTCGGTTGGCTCCAACCTGGGTGACCGCCTGGCACGATTGCGG
TCGGTCGCCGACGGTCTCGGCGATGCGTTGATTGCGGCTTCCCCGATATATGAGGCCGAC
CCCTGGGGTGGGGTGGAGCAGGGGCAGTTCCTCAATGCGGTGCTGATCGCCGACGATCCT
ACCTGCGAACCGCGGGAGTGGCTGCGGCGGGCGCAGGAGTTCGAGCGCGCTGCGGGCAGG
GTGCGTGGCCAGCGCTGGGGTCCACGAAATCTCGACGTCGACCTGATCGCCTGCTACCAG
ACCTCGGCCACCGAGGCTCTGGTCGAAGTGACCGCGCGGGAGAACCACCTCACGCTGCCG
CACCCACTGGCGCATCTGCGGGCCTTTGTGTTGATCCCGTGGATTGCCGTCGACCCAACG
GCGCAGCTGACGGTTGCCGGGTGCCCGCGGCCCGTCACGCGACTGCTGGCCGAGCTGGAG
CCCGCCGACCGCGACAGTGTGCGGTTGTTTAGGCCGTCGTTCGATCTGAATAGCAGACAC
CCCGTCAGTCGGGCACCGGAAAGCTGA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP9WNC7
UniProtKB Entry NameHPPK_MYCTU
General References
Not Available

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00233Aminosalicylic AcidapprovedunknownunknownDetails