Vesicle monoamine transporter type 2

Details

Name
Vesicle monoamine transporter type 2
Synonyms
Not Available
Gene Name
VMAT2
Organism
Human
Amino acid sequence
>lcl|BSEQ0050164|Vesicle monoamine transporter type 2
PIIPSYLYSIKHEKNATEIQTARPVHTASISDSFQSIFSYDNSTMVTGNATRDLTLHQTA
TQHMVTNASAVPSDCPSEDKDLLNENVQVGLLFASKATVQLITNPFIGLLTSRIGYPIPI
FAGFCIMFVSTIMFAFSSSYAFLLIARSLQGIGSSCSSVA
Number of residues
160
Molecular Weight
17291.525
Theoretical pI
Not Available
GO Classification
Processes
transmembrane transport
Components
integral component of membrane
General Function
Not Available
Specific Function
Not Available
Pfam Domain Function
Transmembrane Regions
120-145
Cellular Location
Not Available
Gene sequence
Not Available
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDQ99870
UniProtKB Entry NameQ99870_HUMAN
General References
Not Available

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00182Amphetamineapproved, illicit, investigationalyesDetails
DB11915Valbenazineapproved, investigationalyesantagonistDetails
DB09363Rauwolfia serpentina rootinvestigationalunknowninhibitorDetails
DB12010Fostamatinibapproved, investigationalunknowninhibitorDetails