Divalent metal ion transporter 1

Details

Name
Divalent metal ion transporter 1
Synonyms
Not Available
Gene Name
DMT1
Organism
Pig
Amino acid sequence
>lcl|BSEQ0051599|Divalent metal ion transporter 1
MVLGPEQKTPSEDASGEHGDTASLGAINPAYSHSSLPQSPGGLSEEPFTTYFDEKIAIPE
EEHSCFSFRKLWAFTGPGFLMSIAYLDPGNIESDLQSGAVAGFKLLWILLLATIVGLLLQ
RLAARLGVVTGLHLAEVCHRQYPKVPRIILWLMVELAIIGSDMQEVIGSAIAINLLSVGR
IPLWGGVLITIADTFVFLFLDKYGLRKLEAFFGFLITVMALTFGYEYVTVKPSQSQVLKG
MFLPSCSGCRTPQIEQAVGIVGAVIMPHNMYLHSALVKSRQVNRANKEEVREANKYFFIE
SCIALFVSFIINVFVVSVFAEAFFEKTNQQVVDVCRNSSSPHSDLFPEDNSTLAVDIYKG
GVVLGCYFGPAALYIWAVGILAAGQSSTMTGTYSGQFVMEGFLNLKWSRFARVILTRSIA
IIPTLLVAVFQDVEHLTGMNDFLNVLQSLQLPFALIPILTFTSLRPVMSEFANGIGWRIA
GGILVLIVCSINMYFVVVYVQDLGHVVLYVVAAVVSVAYLSFVFYLGWQCLIALGMSFLD
CGHTVSISKALLTEEATSGNAK
Number of residues
562
Molecular Weight
61450.195
Theoretical pI
Not Available
GO Classification
Functions
metal ion transmembrane transporter activity
Components
integral component of membrane
General Function
Not Available
Specific Function
Metal ion transmembrane transporter activity
Pfam Domain Function
Transmembrane Regions
98-119 181-199 211-228 297-320 362-383 410-429 449-467 479-500 506-528
Cellular Location
Not Available
Gene sequence
>lcl|BSEQ0051600|Divalent metal ion transporter 1 (DMT1)
ATGGTGCTGGGTCCTGAACAGAAGACACCGTCTGAAGATGCTTCTGGAGAACATGGGGAC
ACGGCCAGTCTTGGTGCCATCAACCCTGCCTACAGTCACTCCTCTCTCCCGCAGTCGCCC
GGGGGGCTCTCAGAGGAGCCCTTCACCACCTACTTTGACGAGAAGATCGCCATTCCTGAG
GAGGAGCACTCGTGTTTTAGCTTTCGTAAACTCTGGGCTTTCACGGGACCAGGATTTCTT
ATGAGCATTGCCTACCTGGATCCAGGAAACATCGAGTCTGATTTGCAGTCTGGAGCAGTG
GCTGGATTTAAGTTGCTCTGGATTCTTCTTTTGGCCACCATCGTGGGGCTCCTGCTCCAG
CGCCTTGCGGCTAGACTGGGAGTGGTCACTGGGCTGCATCTTGCTGAAGTGTGTCACCGT
CAGTATCCCAAGGTTCCGCGAATTATCCTATGGCTAATGGTGGAGTTGGCTATCATTGGC
TCAGACATGCAAGAAGTTATTGGCTCAGCTATTGCCATCAATCTCCTATCTGTTGGAAGG
ATTCCTCTCTGGGGTGGAGTTCTCATCACCATTGCAGATACCTTTGTATTTCTCTTTTTG
GACAAGTATGGCTTGCGGAAGCTAGAAGCATTTTTTGGTTTTCTCATCACCGTTATGGCC
CTCACATTTGGATATGAGTATGTTACAGTGAAACCCAGCCAGAGCCAGGTGCTCAAGGGA
ATGTTCCTGCCATCGTGTTCAGGCTGTCGTACCCCACAGATCGAGCAGGCTGTGGGCATC
GTGGGCGCTGTCATCATGCCACACAACATGTACCTGCATTCTGCCCTAGTCAAGTCCAGA
CAGGTAAACCGAGCCAATAAGGAGGAAGTGCGAGAAGCCAATAAGTACTTTTTCATTGAA
TCCTGCATTGCTCTCTTTGTTTCCTTTATCATCAACGTCTTTGTTGTCTCAGTCTTTGCC
GAAGCGTTTTTTGAGAAAACCAACCAGCAGGTGGTTGACGTCTGTAGAAATAGCAGCAGT
CCCCATAGTGACCTTTTTCCTGAGGACAACTCGACACTGGCTGTGGACATCTACAAAGGG
GGCGTGGTGCTAGGGTGTTACTTCGGGCCGGCGGCACTCTACATCTGGGCAGTGGGGATC
CTGGCTGCAGGTCAGAGCTCCACCATGACAGGAACCTACTCCGGCCAGTTCGTCATGGAG
GGATTCCTGAACCTGAAGTGGTCGCGCTTCGCCCGAGTGATCCTGACGCGCTCTATCGCC
ATCATCCCCACTCTGCTGGTGGCCGTCTTCCAGGATGTAGAGCATCTCACAGGGATGAAT
GACTTCCTGAATGTCCTCCAGAGCTTACAACTTCCCTTTGCTCTCATACCCATCCTCACG
TTTACAAGCTTGCGGCCAGTAATGAGTGAATTCGCCAACGGGATAGGCTGGAGGATCGCA
GGCGGTATCTTGGTCCTCATCGTCTGTTCCATCAACATGTACTTCGTCGTGGTTTACGTC
CAGGATCTAGGGCATGTGGTGTTGTATGTGGTGGCTGCCGTGGTCAGCGTAGCTTATCTG
AGCTTCGTGTTTTACTTGGGTTGGCAATGTTTGATTGCACTGGGCATGTCCTTCCTGGAC
TGTGGGCACACGGTAAGCATCTCTAAAGCCCTGCTGACTGAAGAAGCCACCAGTGGCAAT
GCTAAGTAA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDB2ZDZ3
UniProtKB Entry NameB2ZDZ3_PIG
General References
Not Available

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB13257Ferrous sulfate anhydrousapprovedunknowntransporterDetails