Uncharacterized protein

Details

Name
Uncharacterized protein
Synonyms
Not Available
Gene Name
Not Available
Organism
Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)
Amino acid sequence
>lcl|BSEQ0017405|Uncharacterized protein
MPENTAMAALLPEESLFFRELVKQWRAQDSYGTWEKKSDMELLAPYVLDKEQRRAIPIIG
DPDPEILWRVELFYNAVGLATERASGVMVSPMMKMSHEGFGRMVLIAGRLIVVNKQLRDV
HRFGFPSMEKLAEEGDKLVAGALEMIEKFPEVARF
Number of residues
155
Molecular Weight
17701.5
Theoretical pI
5.08
GO Classification
Not Available
General Function
Not Available
Specific Function
Not Available
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Not Available
Gene sequence
>lcl|BSEQ0017406|Uncharacterized protein
ATGCCTGAGAATACTGCAATGGCGGCGCTTTTGCCGGAAGAGTCCCTGTTTTTTCGCGAA
CTGGTCAAGCAGTGGCGGGCACAGGATAGCTATGGTACCTGGGAAAAAAAGTCCGACATG
GAGCTGCTGGCACCCTACGTGCTGGATAAGGAGCAGCGCCGGGCAATACCCATCATTGGT
GACCCCGATCCCGAAATACTTTGGCGGGTGGAACTTTTTTATAACGCCGTGGGGCTGGCT
ACGGAGCGTGCTTCCGGAGTCATGGTGTCCCCCATGATGAAAATGAGTCATGAAGGCTTT
GGCCGCATGGTGCTGATTGCCGGACGTTTGATCGTGGTCAACAAACAGTTGCGCGATGTG
CATCGTTTTGGTTTCCCCAGCATGGAAAAACTGGCCGAAGAAGGTGACAAACTGGTGGCA
GGTGCCCTGGAAATGATCGAGAAATTTCCGGAGGTGGCCCGCTTTTGA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDB7JA91
UniProtKB Entry NameB7JA91_ACIF2
GenBank Protein ID218519790
GenBank Gene IDCP001219
General References
  1. Valdes J, Pedroso I, Quatrini R, Dodson RJ, Tettelin H, Blake R 2nd, Eisen JA, Holmes DS: Acidithiobacillus ferrooxidans metabolism: from genome sequence to industrial applications. BMC Genomics. 2008 Dec 11;9:597. doi: 10.1186/1471-2164-9-597. [PubMed:19077236]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB02580PentaglymeexperimentalunknownDetails