Tripartite terminase subunit 3

Details

Name
Tripartite terminase subunit 3
Synonyms
  • 3.1.-.-
  • Terminase large subunit
Gene Name
TRM3
Organism
Human Cytomegalovirus
Amino acid sequence
>lcl|BSEQ0051324|Tripartite terminase subunit 3
MLRGDSAAKIQERYAELQKRKSHPTSCISTAFTNVAALCRKRYQMMHPELGLAHSCNEAF
LPLMAFCGRHRDYNSPEESQRELLFHERLKSALDELTFRPCSEEQRASYQKLDALTELYR
DPQFQQINNFMTDFKKWLDGGFSTAVEGDAKAIRLEPFQKNLLIHVIFFIAVTKIPVLAN
RVLQYLIHAFQIDFLSQTSIDIFKQKATVFLVPRRHGKTWFIIPIISFLLKHMIGISIGY
VAHQKHVSQFVLKEVEFRCRHTFARDYVVENKDNVISIDHRGAKSTALFASCYNTNSIRG
QNFHLLLVDEAHFIKKEAFNTILGFLAQNTTKIIFISSTNTTSDATCFLTRLNNAPFDML
NVVSYVCEEHLHSFTEKGDATACPCYRLHKPTFISLNSQVRKTANMFMPGAFMDEIIGGT
NKISQNTVLITDQSREEFDILRYSTLNTNAYDYFGKTLYVYLDPAFTTNRKASGTGVAAV
GAYRHQFLIYGLEHFFLRDLSESSEVAIAECAAHMIISVLSLHPYLDELRIAVEGNTNQA
AAVRIACLIRQSVQSSTLIRVLFYHTPDQNHIEQPFYLMGRDKALAVEQFISRFNSGYIK
ASQELVSYTIKLSHDPIEYLLEQIQNLHRVTLAEGTTARYSAKRQNRISDDLIIAVIMAT
YLCDDIHAIRFRVS
Number of residues
674
Molecular Weight
77033.575
Theoretical pI
Not Available
GO Classification
Functions
DNA binding / hydrolase activity
Processes
DNA packaging / viral release from host cell
Components
host cell nucleus
General Function
Component of the molecular motor that translocates viral genomic DNA in empty capsid during DNA packaging. Forms a tripartite terminase complex together with TRM1 and TRM2 in the host cytoplasm. Once the complex reaches the host nucleus, it interacts with the capsid portal vertex. This portal forms a ring in which genomic DNA is translocated into the capsid. TRM3 carries an RNase H-like nuclease activity that plays an important role for the cleavage of concatemeric viral DNA into unit length genomes.
Specific Function
Dna binding
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Host nucleus
Gene sequence
>lcl|BSEQ0051325|Tripartite terminase subunit 3 (TRM3)
ATGTTGCGCGGAGATTCGGCCGCCAAGATCCAGGAGCGCTACGCGGAGCTGCAGAAGCGC
AAGAGCCACCCCACCTCCTGCATCTCCACGGCCTTCACCAATGTGGCGGCGCTGTGCCGC
AAGCGCTACCAGATGATGCACCCCGAACTCGGGCTGGCCCACTCGTGCAACGAGGCCTTC
CTGCCGCTCATGGCCTTCTGCGGCCGCCACCGCGACTACAACTCGCCCGAGGAAAGCCAG
CGCGAGCTGCTGTTTCACGAGCGCCTCAAGAGTGCGCTCGATGAACTGACGTTTCGCCCG
TGCTCCGAGGAGCAGCGCGCCTCCTACCAGAAGCTGGACGCGTTGACCGAGCTCTACCGC
GATCCGCAGTTTCAGCAGATCAACAACTTCATGACCGACTTTAAAAAGTGGCTCGACGGC
GGCTTCAGTACCGCCGTCGAGGGCGACGCAAAAGCCATCCGACTCGAACCGTTTCAAAAG
AATTTATTGATACACGTCATCTTTTTTATAGCCGTGACCAAGATCCCCGTGCTGGCCAAT
CGCGTGCTGCAGTACCTCATCCACGCCTTCCAGATCGACTTCCTCTCGCAGACCTCCATC
GACATCTTTAAGCAGAAAGCCACCGTGTTCCTGGTGCCGCGACGTCACGGCAAGACTTGG
TTCATCATCCCCATTATCTCGTTTCTGCTTAAGCACATGATCGGCATCAGCATCGGCTAC
GTGGCGCACCAAAAGCACGTGTCGCAGTTTGTGCTCAAAGAGGTCGAGTTCCGCTGCCGC
CACACCTTCGCGCGCGACTACGTGGTCGAGAACAAGGACAACGTGATCAGCATCGACCAC
CGCGGCGCCAAGAGCACGGCGCTTTTTGCCAGTTGCTACAACACCAACAGCATCCGAGGA
CAAAACTTCCATTTGCTGCTGGTGGACGAGGCGCACTTCATCAAGAAAGAGGCCTTCAAC
ACCATTCTGGGGTTCCTGGCCCAGAATACCACCAAGATCATCTTCATATCGTCCACCAAC
ACTACCAGTGACGCCACGTGTTTCTTGACGCGCCTCAACAATGCGCCCTTTGACATGCTC
AACGTGGTCTCTTACGTGTGCGAAGAGCACCTGCACAGCTTCACGGAGAAGGGCGACGCC
ACGGCGTGTCCTTGCTACCGACTGCACAAGCCCACCTTCATCAGCCTCAACTCGCAGGTG
CGCAAGACGGCCAACATGTTTATGCCGGGCGCTTTCATGGACGAGATCATCGGCGGTACC
AATAAAATCTCGCAGAACACCGTGCTCATCACGGACCAGAGCCGCGAAGAGTTCGATATT
TTGCGTTACAGCACGCTCAACACCAACGCCTACGATTATTTCGGCAAGACGCTTTACGTG
TATCTGGACCCGGCCTTCACCACCAACCGCAAGGCCTCGGGCACGGGCGTGGCGGCCGTA
GGCGCCTACCGACACCAGTTTCTCATTTACGGCCTAGAGCATTTCTTTTTGCGCGACCTC
TCCGAGAGTTCTGAGGTAGCCATCGCCGAGTGCGCGGCGCACATGATCATCTCGGTGCTG
AGCCTGCACCCTTACCTGGACGAACTGCGTATCGCCGTGGAGGGCAACACCAACCAGGCG
GCGGCCGTGCGCATCGCCTGCCTCATCCGACAGAGCGTGCAGAGCAGCACGCTCATCCGC
GTGCTCTTCTACCACACGCCCGACCAGAACCACATCGAACAGCCCTTCTACCTCATGGGC
CGCGACAAGGCGCTGGCCGTGGAACAGTTCATCTCGCGTTTCAACTCGGGCTACATCAAA
GCCTCGCAAGAGCTCGTCTCCTACACCATCAAGCTGAGCCACGACCCCATCGAGTATCTT
CTGGAGCAGATTCAGAACCTGCACCGCGTCACGCTGGCCGAAGGCACGACGGCACGCTAC
TCGGCCAAGCGCCAGAATCGTATCTCGGACGATCTTATCATCGCCGTCATCATGGCCACC
TACCTGTGTGACGATATACACGCCATCCGTTTCAGGGTCAGCTAG
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDF5HCU8
UniProtKB Entry NameTRM3_HCMVM
General References
  1. Dolan A, Cunningham C, Hector RD, Hassan-Walker AF, Lee L, Addison C, Dargan DJ, McGeoch DJ, Gatherer D, Emery VC, Griffiths PD, Sinzger C, McSharry BP, Wilkinson GW, Davison AJ: Genetic content of wild-type human cytomegalovirus. J Gen Virol. 2004 May;85(Pt 5):1301-12. [PubMed:15105547]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB12070Letermovirapproved, investigationalyesinhibitorDetails