Tripartite terminase subunit 2

Details

Name
Tripartite terminase subunit 2
Synonyms
Not Available
Gene Name
TRM2
Organism
Human Cytomegalovirus
Amino acid sequence
>lcl|BSEQ0051320|Tripartite terminase subunit 2
MSWAKQRVPFLDDDDGEEENDVQDDVDSPVPTRPLVIDEDAEPAAGTSGGLEGGGGDDED
GEDGHALPDLDDDLLLQFEPMLPRVYDLLLPSLDARLNFVNAGQKYAAFLKYVHGDCATC
SHGEILREKTQLLTAIVSKLMDINGILEGKDEPAPGK
Number of residues
157
Molecular Weight
16977.55
Theoretical pI
Not Available
GO Classification
Processes
viral DNA genome packaging / viral release from host cell
Components
host cell nucleus
General Function
Component of the molecular motor that translocates viral genomic DNA in empty capsid during DNA packaging. Forms a tripartite terminase complex together with TRM1 and TRM3 in the host cytoplasm. Once the complex reaches the host nucleus, it interacts with the capsid portal vertex. This portal forms a ring in which genomic DNA is translocated into the capsid.
Specific Function
Not Available
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Host nucleus
Gene sequence
>lcl|BSEQ0051321|Tripartite terminase subunit 2 (TRM2)
ATGTCCTGGGCTAAGCAGCGGGTGCCGTTTCTGGACGATGACGACGGAGAGGAGGAAAAC
GACGTGCAGGATGACGTGGATTCTCCGGTGCCGACGCGACCGCTGGTGATCGACGAGGAC
GCGGAGCCCGCGGCTGGTACGAGCGGTGGGCTCGAGGGGGGAGGTGGTGACGACGAGGAC
GGTGAAGACGGACACGCGCTACCCGATCTTGACGACGATCTGCTATTACAGTTCGAGCCG
ATGCTGCCGCGCGTCTACGATCTGTTGCTGCCCTCTCTGGACGCGCGCTTAAATTTCGTG
AACGCGGGTCAGAAGTACGCCGCCTTCCTCAAGTACGTGCACGGCGACTGCGCGACCTGC
AGTCACGGAGAGATCCTCCGTGAGAAGACGCAACTATTAACGGCGATCGTCAGCAAGCTC
ATGGACATTAACGGAATCCTGGAGGGAAAAGACGAGCCGGCGCCGGGTAAATAA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDF5HGI9
UniProtKB Entry NameTRM2_HCMVM
General References
  1. Dolan A, Cunningham C, Hector RD, Hassan-Walker AF, Lee L, Addison C, Dargan DJ, McGeoch DJ, Gatherer D, Emery VC, Griffiths PD, Sinzger C, McSharry BP, Wilkinson GW, Davison AJ: Genetic content of wild-type human cytomegalovirus. J Gen Virol. 2004 May;85(Pt 5):1301-12. [PubMed:15105547]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB12070Letermovirapproved, investigationalyesinhibitorDetails