Oxygen-insensitive NADPH nitroreductase

Details

Name
Oxygen-insensitive NADPH nitroreductase
Synonyms
  • 1.-.-.-
Gene Name
rdxA
Organism
Helicobacter pylori (strain ATCC 700392 / 26695)
Amino acid sequence
>lcl|BSEQ0013107|Oxygen-insensitive NADPH nitroreductase
MKFLDQEKRRQLLNERHSCKMFDSHYEFSSTELEEIAEIARLSPSSYNTQPWHFVMVTDK
DLKKQIAAHSYFNEEMIKSASALMVVCSLRPSELLPHGHYMQNLYPESYKVRVIPSFAQM
LGVRFNHSMQRLESYILEQCYIAVGQICMGVSLMGLDSCIIGGFDPLKVGEVLEERINKP
KIACLIALGKRVAEASQKSRKSKVDAITWL
Number of residues
210
Molecular Weight
24067.775
Theoretical pI
Not Available
GO Classification
Functions
oxidoreductase activity
Processes
response to antibiotic
General Function
Oxidoreductase activity
Specific Function
Reduction of a variety of nitroaromatic compounds using NADPH as source of reducing equivalents; two electrons are transferred (By similarity). Capable of reducing metronidazole; inactive RdxA renders the bacterium resistant to this compound. The reduction of metronidazole generates hydroxylamine, a potent mutagen and bactericide.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Not Available
Gene sequence
>lcl|BSEQ0013108|Oxygen-insensitive NADPH nitroreductase (rdxA)
ATGAAATTTTTGGATCAAGAAAAAAGAAGACAATTATTAAACGAGCGCCATTCTTGCAAG
ATGTTTGATAGCCATTATGAGTTTTCTAGCACAGAATTAGAAGAAATCGCTGAAATCGCC
AGGCTATCGCCAAGCTCTTACAACACGCAGCCATGGCATTTTGTGATGGTTACTGATAAG
GATTTAAAAAAACAAATTGCAGCGCACAGCTATTTCAATGAAGAGATGATTAAAAGCGCT
TCAGCGTTAATGGTGGTATGCTCTTTAAGACCCAGCGAGTTGTTACCACACGGCCACTAC
ATGCAAAATCTCTATCCGGAGTCTTATAAAGTTAGAGTGATCCCCTCTTTTGCTCAAATG
CTTGGCGTGAGATTCAACCACAGCATGCAAAGATTAGAAAGCTATATTTTAGAGCAATGC
TATATCGCTGTGGGGCAAATTTGCATGGGCGTGAGCTTAATGGGATTGGATAGTTGCATT
ATTGGAGGCTTTGATCCTTTAAAGGTGGGCGAAGTTTTAGAAGAGCGTATCAATAAGCCT
AAAATCGCATGCTTGATCGCTTTGGGCAAGAGGGTGGCAGAAGCGAGTCAAAAATCAAGA
AAATCAAAAGTTGATGCGATTACTTGGTTGTGA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDO25608
UniProtKB Entry NameRDXA_HELPY
General References
  1. Goodwin A, Kersulyte D, Sisson G, Veldhuyzen van Zanten SJ, Berg DE, Hoffman PS: Metronidazole resistance in Helicobacter pylori is due to null mutations in a gene (rdxA) that encodes an oxygen-insensitive NADPH nitroreductase. Mol Microbiol. 1998 Apr;28(2):383-93. [PubMed:9622362]
  2. Paul R, Postius S, Melchers K, Schafer KP: Mutations of the Helicobacter pylori genes rdxA and pbp1 cause resistance against metronidazole and amoxicillin. Antimicrob Agents Chemother. 2001 Mar;45(3):962-5. [PubMed:11181392]
  3. Tomb JF, White O, Kerlavage AR, Clayton RA, Sutton GG, Fleischmann RD, Ketchum KA, Klenk HP, Gill S, Dougherty BA, Nelson K, Quackenbush J, Zhou L, Kirkness EF, Peterson S, Loftus B, Richardson D, Dodson R, Khalak HG, Glodek A, McKenney K, Fitzegerald LM, Lee N, Adams MD, Hickey EK, Berg DE, Gocayne JD, Utterback TR, Peterson JD, Kelley JM, Cotton MD, Weidman JM, Fujii C, Bowman C, Watthey L, Wallin E, Hayes WS, Borodovsky M, Karp PD, Smith HO, Fraser CM, Venter JC: The complete genome sequence of the gastric pathogen Helicobacter pylori. Nature. 1997 Aug 7;388(6642):539-47. [PubMed:9252185]
  4. Debets-Ossenkopp YJ, Pot RG, van Westerloo DJ, Goodwin A, Vandenbroucke-Grauls CM, Berg DE, Hoffman PS, Kusters JG: Insertion of mini-IS605 and deletion of adjacent sequences in the nitroreductase (rdxA) gene cause metronidazole resistance in Helicobacter pylori NCTC11637. Antimicrob Agents Chemother. 1999 Nov;43(11):2657-62. [PubMed:10543743]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00916MetronidazoleapprovedyespotentiatorDetails