PCZA361.16

Details

Name
PCZA361.16
Synonyms
Not Available
Gene Name
Not Available
Organism
Amycolatopsis orientalis
Amino acid sequence
>lcl|BSEQ0016808|PCZA361.16
MQARKLAVDGAIEFTPRVFADDRGLLILPYQEEAFVEAHGGPLFRVAQTIHSMSKRGVVR
GIHYTVTPPGTAKYVYCARGKAMDIVIDIRVGSPTFGQWDSVLMDQQDPRAVYLPVGVGH
AFVALEDDTVMSYMLSRSYVTQDELALSALDPALGLPIDIGVEPIVSDRDRVAITLAEAQ
RQGLLPDYTTSQEIERRLTAVPVST
Number of residues
205
Molecular Weight
22488.53
Theoretical pI
4.86
GO Classification
Functions
dTDP-4-dehydrorhamnose 3,5-epimerase activity
General Function
Dtdp-4-dehydrorhamnose 3,5-epimerase activity
Specific Function
Not Available
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Not Available
Gene sequence
>lcl|BSEQ0004891|618 bp
GTGCAAGCACGCAAACTCGCCGTCGACGGCGCGATCGAGTTCACCCCTCGCGTCTTCGCC
GACGACCGGGGCCTGTTGATCCTGCCGTACCAGGAAGAGGCCTTCGTCGAGGCGCACGGC
GGCCCGCTTTTCCGTGTGGCACAGACGATCCACAGCATGTCCAAGCGCGGCGTGGTGCGG
GGCATCCACTACACCGTGACGCCACCGGGTACCGCCAAATACGTCTACTGCGCCCGCGGC
AAGGCCATGGACATCGTGATCGACATCAGAGTCGGCTCGCCCACGTTCGGGCAGTGGGAC
TCGGTGCTGATGGACCAGCAGGATCCCCGGGCGGTGTACCTTCCGGTCGGCGTCGGCCAT
GCGTTCGTGGCCCTCGAGGACGACACCGTCATGTCGTACATGCTCTCCAGAAGCTATGTG
ACGCAGGACGAACTCGCCCTCTCGGCCCTGGATCCCGCACTGGGCCTGCCCATCGACATC
GGCGTCGAACCGATCGTGTCCGATCGGGACCGGGTGGCCATCACGCTCGCCGAGGCCCAG
CGGCAGGGCCTGCTGCCGGATTACACCACCAGTCAGGAGATCGAGCGGCGGCTGACCGCG
GTCCCCGTCTCGACCTGA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDO52806
UniProtKB Entry NameO52806_AMYOR
GenBank Gene IDAJ223998
General References
  1. van Wageningen AM, Kirkpatrick PN, Williams DH, Harris BR, Kershaw JK, Lennard NJ, Jones M, Jones SJ, Solenberg PJ: Sequencing and analysis of genes involved in the biosynthesis of a vancomycin group antibiotic. Chem Biol. 1998 Mar;5(3):155-62. [PubMed:9545426]
  2. Merkel AB, Temple GK, Burkart MD, Losey HC, Beis K, Walsh CT, Naismith JH: Purification, crystallization and preliminary structural studies of dTDP-4-keto-6-deoxy-glucose-5-epimerase (EvaD) from Amycolatopsis orientalis, the fourth enzyme in the dTDP-L-epivancosamine biosynthetic pathway. Acta Crystallogr D Biol Crystallogr. 2002 Jul;58(Pt 7):1226-8. Epub 2002 Jun 20. [PubMed:12077451]
  3. Merkel AB, Major LL, Errey JC, Burkart MD, Field RA, Walsh CT, Naismith JH: The position of a key tyrosine in dTDP-4-Keto-6-deoxy-D-glucose-5-epimerase (EvaD) alters the substrate profile for this RmlC-like enzyme. J Biol Chem. 2004 Jul 30;279(31):32684-91. Epub 2004 May 24. [PubMed:15159413]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB01643Thymidine monophosphateexperimentalunknownDetails