Cytochrome c2

Details

Name
Cytochrome c2
Synonyms
  • Cytochrome c2 precursor
Gene Name
cycA
Organism
Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Amino acid sequence
>lcl|BSEQ0016927|Cytochrome c2
MVKKLLTILSIAATAGSLSIGTASAQDAKAGEAVFKQCMTCHRADKNMVGPALGGVVGRK
AGTAAGFTYSPLNHNSGEAGLVWTADNIINYLNDPNAFLKKFLTDKGKADQAVGVTKMTF
KLANEQQRKDVVAYLATLK
Number of residues
139
Molecular Weight
14632.81
Theoretical pI
10.14
GO Classification
Functions
electron carrier activity / heme binding / metal ion binding
Processes
oxidation-reduction process / photosynthesis
General Function
Metal ion binding
Specific Function
Cytochrome c2 is found mainly in purple, non-sulfur, photosynthetic bacteria where it functions as the electron donor to the oxidized bacteriochlorophyll in the photophosphorylation pathway. However, it may also have a role in the respiratory chain and is found in some non-photosynthetic bacteria.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Not Available
Gene sequence
>lcl|BSEQ0016928|Cytochrome c2 (cycA)
GTGGTCAAAAAACTTCTCACAATTCTCAGCATCGCCGCTACCGCCGGATCTCTGTCGATC
GGCACTGCCTCGGCCCAGGACGCCAAGGCGGGTGAGGCGGTGTTCAAACAGTGCATGACC
TGCCACCGCGCCGACAAGAACATGGTCGGTCCGGCTCTGGGCGGCGTCGTCGGTCGTAAG
GCCGGTACCGCGGCTGGCTTCACCTATTCGCCGCTGAACCACAATTCGGGTGAAGCGGGT
CTGGTCTGGACCGCCGACAACATCATCAACTACCTGAACGATCCGAACGCGTTCCTGAAG
AAGTTCCTGACCGATAAGGGTAAGGCTGATCAGGCGGTCGGTGTCACCAAGATGACCTTC
AAGCTCGCCAACGAGCAGCAGCGTAAGGACGTGGTCGCCTATCTGGCCACCCTCAAGTAA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP00091
UniProtKB Entry NameCYC22_RHOPA
GenBank Gene IDBX572597
General References
  1. Larimer FW, Chain P, Hauser L, Lamerdin J, Malfatti S, Do L, Land ML, Pelletier DA, Beatty JT, Lang AS, Tabita FR, Gibson JL, Hanson TE, Bobst C, Torres JL, Peres C, Harrison FH, Gibson J, Harwood CS: Complete genome sequence of the metabolically versatile photosynthetic bacterium Rhodopseudomonas palustris. Nat Biotechnol. 2004 Jan;22(1):55-61. Epub 2003 Dec 14. [PubMed:14704707]
  2. Ambler RP, Daniel M, Hermoso J, Meyer TE, Bartsch RG, Kamen MD: Cytochrome c2 sequence variation among the recognised species of purple nonsulphur photosynthetic bacteria. Nature. 1979 Apr 12;278(5705):659-60. [PubMed:221822]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB03088Pidolic Acidapproved, investigationalunknownDetails
DB03317Heme CexperimentalunknownDetails