Cytochrome c-551

Details

Name
Cytochrome c-551
Synonyms
  • Cytochrome c551
  • Cytochrome C8
Gene Name
nirM
Organism
Pseudomonas stutzeri
Amino acid sequence
>lcl|BSEQ0012138|Cytochrome c-551
MKKILIPMLALGGALAMQPALAQDGEALFKSKPCAACHSVDTKMVGPALKEVAAKNAGVE
GAADTLALHIKNGSQGVWGPIPMPPNPVTEEEAKILAEWVLSLK
Number of residues
104
Molecular Weight
10796.685
Theoretical pI
7.42
GO Classification
Functions
electron carrier activity / heme binding / iron ion binding
Processes
oxidation-reduction process
Components
periplasmic space
General Function
Iron ion binding
Specific Function
Electron donor for cytochrome cd1 in nitrite and nitrate respiration.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Periplasm
Gene sequence
>lcl|BSEQ0005965|315 bp
ATGAAAAAAATTCTAATCCCGATGCTCGCCCTCGGCGGCGCGCTGGCCATGCAGCCGGCG
CTGGCGCAAGACGGTGAAGCGCTGTTCAAGAGCAAGCCTTGCGCGGCCTGCCACAGCGTC
GACACCAAGATGGTTGGCCCGGCTCTGAAAGAAGTCGCCGCCAAGAATGCCGGCGTCGAA
GGCGCTGCCGACACCCTGGCTCTGCACATCAAGAATGGCAGCCAAGGCGTTTGGGGCCCG
ATCCCGATGCCGCCAAACCCAGTCACCGAGGAGGAAGCCAAGATCCTCGCCGAGTGGGTT
CTTAGCCTCAAGTAA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP00101
UniProtKB Entry NameCY551_PSEST
GenBank Gene IDX56813
General References
  1. Jungst A, Wakabayashi S, Matsubara H, Zumft WG: The nirSTBM region coding for cytochrome cd1-dependent nitrite respiration of Pseudomonas stutzeri consists of a cluster of mono-, di-, and tetraheme proteins. FEBS Lett. 1991 Feb 25;279(2):205-9. [PubMed:2001732]
  2. Ambler RP, Wynn M: The amino acid sequences of cytochromes c-551 from three species of Pseudomonas. Biochem J. 1973 Mar;131(3):485-98. [PubMed:4352718]
  3. Cai M, Bradford EG, Timkovich R: Investigation of the solution conformation of cytochrome c-551 from Pseudomonas stutzeri. Biochemistry. 1992 Sep 15;31(36):8603-12. [PubMed:1327105]
  4. Cai M, Timkovich R: Solution conformation of cytochrome c-551 from Pseudomonas stutzeri ZoBell determined by NMR. Biophys J. 1994 Sep;67(3):1207-15. [PubMed:7811935]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB03317Heme CexperimentalunknownDetails