Cytochrome c'

Details

Name
Cytochrome c'
Synonyms
  • Cytochrome c' precursor
Gene Name
cycP
Organism
Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158)
Amino acid sequence
>lcl|BSEQ0012140|Cytochrome c'
MRRVLLATLMAALPAAAMAADAEHVVEARKGYFSLVALEFGPLAAMAKGEMPYDAAAAKA
HASDLVTLTKYDPSDLYAPGTSADDVKGTAAKAAIWQDADGFQAKGMAFFEAVAALEPAA
GAGQKELAAAVGKVGGTCKSCHDDFRVKR
Number of residues
149
Molecular Weight
15362.42
Theoretical pI
6.25
GO Classification
Functions
electron carrier activity / heme binding / iron ion binding
Processes
electron transport chain
Components
periplasmic space
General Function
Iron ion binding
Specific Function
Cytochrome c' is the most widely occurring bacterial c-type cytochrome. Cytochromes c' are high-spin proteins and the heme has no sixth ligand. Their exact function is not known.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Not Available
Gene sequence
>lcl|BSEQ0012141|Cytochrome c' (cycP)
ATGAGACGAGTTCTTCTAGCCACCCTGATGGCCGCCCTTCCCGCCGCAGCCATGGCTGCC
GATGCCGAACATGTGGTCGAGGCCCGCAAGGGCTATTTCTCCCTCGTGGCTCTCGAATTC
GGGCCGCTTGCCGCGATGGCCAAGGGCGAGATGCCCTATGATGCCGCGGCCGCCAAGGCG
CATGCGTCCGATCTCGTGACCCTGACCAAATACGATCCCTCCGACCTCTACGCCCCCGGC
ACCTCGGCGGACGATGTGAAGGGCACGGCCGCGAAGGCCGCGATCTGGCAGGATGCAGAT
GGCTTCCAGGCGAAGGGCATGGCCTTCTTCGAGGCGGTGGCGGCCCTCGAACCTGCGGCC
GGCGCGGGCCAGAAGGAGCTGGCCGCCGCCGTGGGCAAGGTCGGCGGCACCTGCAAATCC
TGCCACGACGACTTCCGGGTGAAGAGATAA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP00148
UniProtKB Entry NameCYCP_RHOS4
GenBank Gene IDCP000143
General References
  1. Ambler RP, Bartsch RG, Daniel M, Kamen MD, McLellan L, Meyer TE, Van Beeumen J: Amino acid sequences of bacterial cytochromes c' and c-556. Proc Natl Acad Sci U S A. 1981 Nov;78(11):6854-7. [PubMed:6273892]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB03317Heme CexperimentalunknownDetails