Thymidylate synthase

Details

Name
Thymidylate synthase
Synonyms
  • 2.1.1.45
  • TS
Gene Name
thyA
Organism
Lactobacillus casei
Amino acid sequence
>lcl|BSEQ0002980|Thymidylate synthase
MLEQPYLDLAKKVLDEGHFKPDRTHTGTYSIFGHQMRFDLSKGFPLLTTKKVPFGLIKSE
LLWFLHGDTNIRFLLQHRNHIWDEWAFEKWVKSDEYHGPDMTDFGHRSQKDPEFAAVYHE
EMAKFDDRVLHDDAFAAKYGDLGLVYGSQWRAWHTSKGDTIDQLGDVIEQIKTHPYSRRL
IVSAWNPEDVPTMALPPCHTLYQFYVNDGKLSLQLYQRSADIFLGVPFNIASYALLTHLV
AHECGLEVGEFIHTFGDAHLYVNHLDQIKEQLSRTPRPAPTLQLNPDKHDIFDFDMKDIK
LLNYDPYPAIKAPVAV
Number of residues
316
Molecular Weight
36579.235
Theoretical pI
6.28
GO Classification
Functions
thymidylate synthase activity
Processes
dTMP biosynthetic process / dTTP biosynthetic process
Components
cytoplasm
General Function
Thymidylate synthase activity
Specific Function
Provides the sole de novo source of dTMP for DNA biosynthesis.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Cytoplasm
Gene sequence
>lcl|BSEQ0002979|990 bp
ATGTGTCGAGTAGTGAACGGTAAAGGAGCAGAGCAGACAATGTTAGAACAGCCATATCTT
GATCTTGCAAAAAAAGTTCTGGATGAAGGCCATTTCAAGCCTGATCGGACCCATACAGGA
ACTTACAGTATTTTCGGCCACCAAATGCGTTTCGACCTTAGCAAGGGCTTTCCATTACTG
ACGACCAAAAAAGTACCATTCGGCCTTATTAAGAGTGAGTTGTTGTGGTTTTTACACGGT
GATACCAACATTCGGTTCTTACTCCAACACAGGAATCACATTTGGGATGAGTGGGCGTTT
GAAAAATGGGTGAAGAGTGATGAATATCACGGCCCGGACATGACTGATTTTGGGCATCGC
AGCCAAAAGGATCCGGAATTCGCGGCAGTTTATCATGAAGAAATGGCTAAATTCGATGAC
CGGGTGCTTCATGATGATGCTTTTGCAGCCAAATATGGTGATCTTGGCTTGGTTTATGGA
TCCCAATGGCGGGCCTGGCATACGAGCAAGGGTGACACGATCGACCAGTTGGGGGACGTT
ATTGAGCAAATCAAAACGCATCCCTATTCACGACGGCTCATCGTGTCGGCGTGGAATCCG
GAAGATGTCCCGACAATGGCGCTACCGCCTTGTCACACGCTCTATCAGTTTTATGTCAAT
GATGGCAAGCTGTCTTTGCAGTTGTACCAACGTTCGGCTGACATTTTTCTTGGCGTCCCG
TTTAATATCGCGTCCTATGCGTTGTTAACGCATCTGGTCGCGCATGAATGTGGCCTTGAA
GTTGGCGAATTCATTCATACATTCGGCGATGCGCATCTTTACGTCAATCATCTTGACCAA
ATTAAAGAGCAGCTCAGTCGCACGCCGCGGCCGGCACCGACTTTACAGTTGAATCCGGAT
AAACATGATATTTTCGACTTTGACATGAAGGATATTAAGTTGCTTAATTACGATCCTTAT
CCGGCCATTAAGGCACCGGTTGCCGTTTAA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP00469
UniProtKB Entry NameTYSY_LACCA
GenBank Protein ID149601
GenBank Gene IDM19653
General References
  1. Pinter K, Davisson VJ, Santi DV: Cloning, sequencing, and expression of the Lactobacillus casei thymidylate synthase gene. DNA. 1988 May;7(4):235-41. [PubMed:2840247]
  2. Maley GF, Bellisario RL, Guarino DU, Maley F: The primary structure of Lactobacillus casei thymidylate synthetase. III. The use of 2-(2-nitrophenylsulfenyl)-3-methyl-3-bromoindolenine and limited tryptic peptides to establish the complete amino acid sequence of the enzyme. J Biol Chem. 1979 Feb 25;254(4):1301-4. [PubMed:105005]
  3. Perry KM, Fauman EB, Finer-Moore JS, Montfort WR, Maley GF, Maley F, Stroud RM: Plastic adaptation toward mutations in proteins: structural comparison of thymidylate synthases. Proteins. 1990;8(4):315-33. [PubMed:2128651]
  4. Finer-Moore J, Fauman EB, Foster PG, Perry KM, Santi DV, Stroud RM: Refined structures of substrate-bound and phosphate-bound thymidylate synthase from Lactobacillus casei. J Mol Biol. 1993 Aug 20;232(4):1101-16. [PubMed:8371269]
  5. Kealey JT, Eckstein J, Santi DV: Role of the conserved tryptophan 82 of Lactobacillus casei thymidylate synthase. Chem Biol. 1995 Sep;2(9):609-14. [PubMed:9383465]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB023015,10-Methylene-6-Hydrofolic AcidexperimentalunknownDetails
DB0354110-Propargyl-5,8-Dideazafolic AcidexperimentalunknownDetails
DB03685Uridine monophosphateexperimentalunknownDetails
DB037615-Fluoro-2'-Deoxyuridine-5'-MonophosphateexperimentalunknownDetails
DB037982'-Deoxycytidine-5'-MonophosphateexperimentalunknownDetails
DB03800Deoxyuridine monophosphateexperimentalunknownDetails
DB01643Thymidine monophosphateexperimentalunknownDetails
DB068602-(2-chloropyridin-4-yl)-4-methyl-1H-isoindole-1,3(2H)-dioneexperimentalunknownDetails
DB075072-(4-hydroxybiphenyl-3-yl)-4-methyl-1H-isoindole-1,3(2H)-dioneexperimentalunknownDetails
DB075114-(4-methyl-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)benzonitrileexperimentalunknownDetails
DB082043-DIPHENOL-6-NITRO-3H-BENZO[DE]ISOCHROMEN-1-ONEexperimentalunknownDetails