Platelet-derived growth factor subunit B

Details

Name
Platelet-derived growth factor subunit B
Synonyms
  • PDGF subunit B
  • PDGF-2
  • PDGF2
  • Platelet-derived growth factor B chain
  • Platelet-derived growth factor beta polypeptide
  • Proto-oncogene c-Sis
  • SIS
Gene Name
PDGFB
Organism
Humans
Amino acid sequence
>lcl|BSEQ0006767|Platelet-derived growth factor subunit B
MNRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGDPGEEDGAEL
DLNMTRSHSGGELESLARGRRSLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLV
WPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKC
ETVAAARPVTRSPGGSQEQRAKTPQTRVTIRTVRVRRPPKGKHRKFKHTHDKTALKETLG
A
Number of residues
241
Molecular Weight
27283.19
Theoretical pI
9.5
GO Classification
Functions
chemoattractant activity / collagen binding / growth factor activity / identical protein binding / platelet-derived growth factor binding / platelet-derived growth factor receptor binding / protein heterodimerization activity / protein homodimerization activity / superoxide-generating NADPH oxidase activator activity
Processes
activation of MAPKK activity / activation of protein kinase activity / activation of protein kinase B activity / axon guidance / blood coagulation / cell chemotaxis / cell growth / cellular response to growth factor stimulus / cellular response to mycophenolic acid / DNA replication / embryonic placenta development / epidermal growth factor receptor signaling pathway / extracellular matrix organization / Fc-epsilon receptor signaling pathway / fibroblast growth factor receptor signaling pathway / heart development / innate immune response / insulin receptor signaling pathway / MAPK cascade / metanephric glomerular mesangial cell development / monocyte chemotaxis / negative regulation of phosphatidylinositol biosynthetic process / negative regulation of platelet activation / negative regulation of protein binding / negative regulation of transcription, DNA-templated / neurotrophin TRK receptor signaling pathway / paracrine signaling / peptidyl-serine phosphorylation / peptidyl-tyrosine phosphorylation / phosphatidylinositol-mediated signaling / platelet activation / platelet degranulation / platelet-derived growth factor receptor signaling pathway / positive chemotaxis / positive regulation of blood vessel endothelial cell migration / positive regulation of calcium ion import / positive regulation of cell migration / positive regulation of cell proliferation / positive regulation of chemotaxis / positive regulation of cyclin-dependent protein serine/threonine kinase activity / positive regulation of DNA biosynthetic process / positive regulation of DNA replication / positive regulation of endothelial cell proliferation / positive regulation of ERK1 and ERK2 cascade / positive regulation of fibroblast proliferation / positive regulation of gene expression / positive regulation of glomerular filtration / positive regulation of glomerular mesangial cell proliferation / positive regulation of hyaluronan biosynthetic process / positive regulation of MAP kinase activity / positive regulation of MAPK cascade / positive regulation of metanephric mesenchymal cell migration / positive regulation of metanephric mesenchymal cell migration by platelet-derived growth factor receptor-beta signaling pathway / positive regulation of mitotic nuclear division / positive regulation of peptidyl-tyrosine phosphorylation / positive regulation of phosphatidylinositol 3-kinase activity / positive regulation of phosphatidylinositol 3-kinase signaling / positive regulation of protein autophosphorylation / positive regulation of protein tyrosine kinase activity / positive regulation of reactive oxygen species metabolic process / positive regulation of smooth muscle cell migration / positive regulation of smooth muscle cell proliferation / positive regulation of transcription, DNA-templated / protein kinase C signaling / protein phosphorylation / Ras protein signal transduction / reactive oxygen species metabolic process / response to drug / response to estradiol / response to hypoxia / response to wounding / small GTPase mediated signal transduction / transforming growth factor beta receptor signaling pathway / vascular endothelial growth factor receptor signaling pathway
Components
basolateral plasma membrane / cell surface / cytoplasm / endoplasmic reticulum lumen / extracellular region / extracellular space / Golgi membrane / platelet alpha granule lumen
General Function
Superoxide-generating nadph oxidase activator activity
Specific Function
Growth factor that plays an essential role in the regulation of embryonic development, cell proliferation, cell migration, survival and chemotaxis. Potent mitogen for cells of mesenchymal origin. Required for normal proliferation and recruitment of pericytes and vascular smooth muscle cells in the central nervous system, skin, lung, heart and placenta. Required for normal blood vessel development, and for normal development of kidney glomeruli. Plays an important role in wound healing. Signaling is modulated by the formation of heterodimers with PDGFA (By similarity).
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Secreted
Gene sequence
>lcl|BSEQ0012435|Platelet-derived growth factor subunit B (PDGFB)
ATGAATCGCTGCTGGGCGCTCTTCCTGTCTCTCTGCTGCTACCTGCGTCTGGTCAGCGCC
GAGGGGGACCCCATTCCCGAGGAGCTTTATGAGATGCTGAGTGACCACTCGATCCGCTCC
TTTGATGATCTCCAACGCCTGCTGCACGGAGACCCCGGAGAGGAAGATGGGGCCGAGTTG
GACCTGAACATGACCCGCTCCCACTCTGGAGGCGAGCTGGAGAGCTTGGCTCGTGGAAGA
AGGAGCCTGGGTTCCCTGACCATTGCTGAGCCGGCCATGATCGCCGAGTGCAAGACGCGC
ACCGAGGTGTTCGAGATCTCCCGGCGCCTCATAGACCGCACCAACGCCAACTTCCTGGTG
TGGCCGCCCTGTGTGGAGGTGCAGCGCTGCTCCGGCTGCTGCAACAACCGCAACGTGCAG
TGCCGCCCCACCCAGGTGCAGCTGCGACCTGTCCAGGTGAGAAAGATCGAGATTGTGCGG
AAGAAGCCAATCTTTAAGAAGGCCACGGTGACGCTGGAAGACCACCTGGCATGCAAGTGT
GAGACAGTGGCAGCTGCACGGCCTGTGACCCGAAGCCCGGGGGGTTCCCAGGAGCAGCGA
GCCAAAACGCCCCAAACTCGGGTGACCATTCGGACGGTGCGAGTCCGCCGGCCCCCCAAG
GGCAAGCACCGGAAATTCAAGCACACGCATGACAAGACGGCACTGAAGGAGACCCTTGGA
GCCTAG
Chromosome Location
22
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP01127
UniProtKB Entry NamePDGFB_HUMAN
GenBank Gene IDX00561
GenAtlas IDPDGFB
HGNC IDHGNC:8800
General References
  1. Josephs SF, Ratner L, Clarke MF, Westin EH, Reitz MS, Wong-Staal F: Transforming potential of human c-sis nucleotide sequences encoding platelet-derived growth factor. Science. 1984 Aug 10;225(4662):636-9. [Article]
  2. Collins T, Ginsburg D, Boss JM, Orkin SH, Pober JS: Cultured human endothelial cells express platelet-derived growth factor B chain: cDNA cloning and structural analysis. Nature. 1985 Aug 22-28;316(6030):748-50. [Article]
  3. Ratner L, Josephs SF, Jarrett R, Reitz MS Jr, Wong-Staal F: Nucleotide sequence of transforming human c-sis cDNA clones with homology to platelet-derived growth factor. Nucleic Acids Res. 1985 Jul 25;13(14):5007-18. [Article]
  4. Rao CD, Igarashi H, Pech MW, Robbins KC, Aaronson SA: Oncogenic potential of the human platelet-derived growth factor transcriptional unit. Cold Spring Harb Symp Quant Biol. 1986;51 Pt 2:959-66. [Article]
  5. Rao CD, Igarashi H, Chiu IM, Robbins KC, Aaronson SA: Structure and sequence of the human c-sis/platelet-derived growth factor 2 (SIS/PDGF2) transcriptional unit. Proc Natl Acad Sci U S A. 1986 Apr;83(8):2392-6. [Article]
  6. Collins JE, Wright CL, Edwards CA, Davis MP, Grinham JA, Cole CG, Goward ME, Aguado B, Mallya M, Mokrab Y, Huckle EJ, Beare DM, Dunham I: A genome annotation-driven approach to cloning the human ORFeome. Genome Biol. 2004;5(10):R84. Epub 2004 Sep 30. [Article]
  7. Dunham I, Shimizu N, Roe BA, Chissoe S, Hunt AR, Collins JE, Bruskiewich R, Beare DM, Clamp M, Smink LJ, Ainscough R, Almeida JP, Babbage A, Bagguley C, Bailey J, Barlow K, Bates KN, Beasley O, Bird CP, Blakey S, Bridgeman AM, Buck D, Burgess J, Burrill WD, O'Brien KP, et al.: The DNA sequence of human chromosome 22. Nature. 1999 Dec 2;402(6761):489-95. [Article]
  8. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
  9. Dirks RP, Onnekink C, Jansen HJ, de Jong A, Bloemers HP: A novel human c-sis mRNA species is transcribed from a promoter in c-sis intron 1 and contains the code for an alternative PDGF B-like protein. Nucleic Acids Res. 1995 Aug 11;23(15):2815-22. [Article]
  10. Simon MP, Pedeutour F, Sirvent N, Grosgeorge J, Minoletti F, Coindre JM, Terrier-Lacombe MJ, Mandahl N, Craver RD, Blin N, Sozzi G, Turc-Carel C, O'Brien KP, Kedra D, Fransson I, Guilbaud C, Dumanski JP: Deregulation of the platelet-derived growth factor B-chain gene via fusion with collagen gene COL1A1 in dermatofibrosarcoma protuberans and giant-cell fibroblastoma. Nat Genet. 1997 Jan;15(1):95-8. [Article]
  11. Chiu IM, Reddy EP, Givol D, Robbins KC, Tronick SR, Aaronson SA: Nucleotide sequence analysis identifies the human c-sis proto-oncogene as a structural gene for platelet-derived growth factor. Cell. 1984 May;37(1):123-9. [Article]
  12. Weich HA, Sebald W, Schairer HU, Hoppe J: The human osteosarcoma cell line U-2 OS expresses a 3.8 kilobase mRNA which codes for the sequence of the PDGF-B chain. FEBS Lett. 1986 Mar 31;198(2):344-8. [Article]
  13. Waterfield MD, Scrace GT, Whittle N, Stroobant P, Johnsson A, Wasteson A, Westermark B, Heldin CH, Huang JS, Deuel TF: Platelet-derived growth factor is structurally related to the putative transforming protein p28sis of simian sarcoma virus. Nature. 1983 Jul 7-13;304(5921):35-9. [Article]
  14. Antoniades HN, Hunkapiller MW: Human platelet-derived growth factor (PDGF): amino-terminal amino acid sequence. Science. 1983 May 27;220(4600):963-5. [Article]
  15. Johnsson A, Heldin CH, Wasteson A, Westermark B, Deuel TF, Huang JS, Seeburg PH, Gray A, Ullrich A, Scrace G, et al.: The c-sis gene encodes a precursor of the B chain of platelet-derived growth factor. EMBO J. 1984 May;3(5):921-8. [Article]
  16. Clements JM, Bawden LJ, Bloxidge RE, Catlin G, Cook AL, Craig S, Drummond AH, Edwards RM, Fallon A, Green DR, et al.: Two PDGF-B chain residues, arginine 27 and isoleucine 30, mediate receptor binding and activation. EMBO J. 1991 Dec;10(13):4113-20. [Article]
  17. Andersson M, Ostman A, Backstrom G, Hellman U, George-Nascimento C, Westermark B, Heldin CH: Assignment of interchain disulfide bonds in platelet-derived growth factor (PDGF) and evidence for agonist activity of monomeric PDGF. J Biol Chem. 1992 Jun 5;267(16):11260-6. [Article]
  18. LaRochelle WJ, Jeffers M, McDonald WF, Chillakuru RA, Giese NA, Lokker NA, Sullivan C, Boldog FL, Yang M, Vernet C, Burgess CE, Fernandes E, Deegler LL, Rittman B, Shimkets J, Shimkets RA, Rothberg JM, Lichenstein HS: PDGF-D, a new protease-activated growth factor. Nat Cell Biol. 2001 May;3(5):517-21. [Article]
  19. Sandberg AA, Anderson WD, Fredenberg C, Hashimoto H: Dermatofibrosarcoma protuberans of breast. Cancer Genet Cytogenet. 2003 Apr 1;142(1):56-9. [Article]
  20. Andrae J, Gallini R, Betsholtz C: Role of platelet-derived growth factors in physiology and medicine. Genes Dev. 2008 May 15;22(10):1276-312. doi: 10.1101/gad.1653708. [Article]
  21. Oefner C, D'Arcy A, Winkler FK, Eggimann B, Hosang M: Crystal structure of human platelet-derived growth factor BB. EMBO J. 1992 Nov;11(11):3921-6. [Article]
  22. Shim AH, Liu H, Focia PJ, Chen X, Lin PC, He X: Structures of a platelet-derived growth factor/propeptide complex and a platelet-derived growth factor/receptor complex. Proc Natl Acad Sci U S A. 2010 Jun 22;107(25):11307-12. doi: 10.1073/pnas.1000806107. Epub 2010 Jun 2. [Article]
  23. Keller A, Westenberger A, Sobrido MJ, Garcia-Murias M, Domingo A, Sears RL, Lemos RR, Ordonez-Ugalde A, Nicolas G, da Cunha JE, Rushing EJ, Hugelshofer M, Wurnig MC, Kaech A, Reimann R, Lohmann K, Dobricic V, Carracedo A, Petrovic I, Miyasaki JM, Abakumova I, Mae MA, Raschperger E, Zatz M, Zschiedrich K, Klepper J, Spiteri E, Prieto JM, Navas I, Preuss M, Dering C, Jankovic M, Paucar M, Svenningsson P, Saliminejad K, Khorshid HR, Novakovic I, Aguzzi A, Boss A, Le Ber I, Defer G, Hannequin D, Kostic VS, Campion D, Geschwind DH, Coppola G, Betsholtz C, Klein C, Oliveira JR: Mutations in the gene encoding PDGF-B cause brain calcifications in humans and mice. Nat Genet. 2013 Sep;45(9):1077-82. doi: 10.1038/ng.2723. Epub 2013 Aug 4. [Article]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB06325PegpleranibinvestigationalunknownDetails