Ig kappa chain C region
Details
- Name
- Ig kappa chain C region
- Synonyms
- Not Available
- Gene Name
- IGKC
- Organism
- Humans
- Amino acid sequence
>lcl|BSEQ0012677|Ig kappa chain C region TVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDS KDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
- Number of residues
- 106
- Molecular Weight
- 11608.765
- Theoretical pI
- 5.68
- GO Classification
- Functionsantigen binding / immunoglobulin receptor bindingProcessesB cell receptor signaling pathway / complement activation / complement activation, classical pathway / defense response to bacterium / Fc-epsilon receptor signaling pathway / Fc-gamma receptor signaling pathway involved in phagocytosis / immune response / innate immune response / phagocytosis, engulfment / phagocytosis, recognition / positive regulation of B cell activation / receptor-mediated endocytosis / regulation of immune response / retina homeostasisComponentsblood microparticle / external side of plasma membrane / extracellular exosome / extracellular region / extracellular space / immunoglobulin complex, circulating / plasma membrane
- General Function
- Immunoglobulin receptor binding
- Specific Function
- Not Available
- Pfam Domain Function
- C1-set (PF07654)
- Transmembrane Regions
- Not Available
- Cellular Location
- Not Available
- Chromosome Location
- Not Available
- Locus
- 2p12
- External Identifiers
Resource Link UniProtKB ID P01834 UniProtKB Entry Name IGKC_HUMAN GenBank Protein ID 185945 GenBank Gene ID J00241 HGNC ID HGNC:5716 - General References
- Gottlieb PD, Cunningham BA, Rutishauser U, Edelman GM: The covalent structure of a human gamma G-immunoglobulin. VI. Amino acid sequence of the light chain. Biochemistry. 1970 Aug 4;9(16):3155-61. [Article]
- Gall WE, Edelman GM: The covalent structure of a human gamma G-immunoglobulin. X. Intrachain disulfide bonds. Biochemistry. 1970 Aug 4;9(16):3188-96. [Article]
- Suter L, Barnikol HU, Watanabe S, Hilschmann N: [Rule of antibody structure. The primary structure of a monoclonal immunoglobulin L-chain of kappa-type, subgroup 3 (Bence-Jones protein Ti). IV. The complete amino acid sequence and its significance for the mechanism of antibody production]. Hoppe Seylers Z Physiol Chem. 1972 Feb;353(2):189-208. [Article]
- Hieter PA, Max EE, Seidman JG, Maizel JV Jr, Leder P: Cloned human and mouse kappa immunoglobulin constant and J region genes conserve homology in functional segments. Cell. 1980 Nov;22(1 Pt 1):197-207. [Article]
- Hilschmann N: [The complete amino acid sequence of Bence Jones protein Cum (kappa-type)]. Hoppe Seylers Z Physiol Chem. 1967 Dec;348(12):1718-22. [Article]
- Titani K, Shinoda T, Putnam FW: The amino acid sequence of a kappa type Bence-Jones protein. 3. The complete sequence and the location of the disulfide bridges. J Biol Chem. 1969 Jul 10;244(13):3550-60. [Article]
- Kohler H, Shimizu A, Paul C, Putnam FW: Macroglobulin structure: variable sequence of light and heavy chains. Science. 1970 Jul 3;169(3940):56-9. [Article]
- Olsen KE, Sletten K, Westermark P: Extended analysis of AL-amyloid protein from abdominal wall subcutaneous fat biopsy: kappa IV immunoglobulin light chain. Biochem Biophys Res Commun. 1998 Apr 28;245(3):713-6. [Article]
- Azkargorta M, Soria J, Ojeda C, Guzman F, Acera A, Iloro I, Suarez T, Elortza F: Human Basal Tear Peptidome Characterization by CID, HCD, and ETD Followed by in Silico and in Vitro Analyses for Antimicrobial Peptide Identification. J Proteome Res. 2015 Jun 5;14(6):2649-58. doi: 10.1021/acs.jproteome.5b00179. Epub 2015 May 20. [Article]
- Stavnezer-Nordgren J, Kekish O, Zegers BJ: Molecular defects in a human immunoglobulin kappa chain deficiency. Science. 1985 Oct 25;230(4724):458-61. [Article]
Drug Relations
- Drug Relations
DrugBank ID Name Drug group Pharmacological action? Actions Details DB07375 Etiocholanedione experimental unknown Details DB07416 (2S)-2-(BUTYRYLOXY)-3-HYDROXYPROPYL NONANOATE experimental unknown Details DB07441 3-{[(9-CYANO-9,10-DIHYDRO-10-METHYLACRIDIN-9-YL)CARBONYL]AMINO}PROPANOIC ACID experimental unknown Details DB04688 Methylecgonine experimental unknown Details DB07716 (4Z)-2,8:7,12:11,15:14,18:17,22-PENTAANHYDRO-4,5,6,9,10,13,19,20,21-NONADEOXY-D-ARABINO-D-ALLO-D-ALLO-DOCOSA-4,9,20-TRIENITOL experimental unknown Details DB07784 [4-(4-ACETYLAMINO-PHENYL)-3,5-DIOXO-4-AZA-TRICYCLO[5.2.2.0 2,6]UNDEC-1-YLCARBAMOYLOXY]-ACETIC ACID experimental unknown Details DB07882 4-{4-[2-(1A,7A-DIMETHYL-4-OXY-OCTAHYDRO-1-OXA-4-AZA-CYCLOPROPA[A]NAPHTHALEN-4-YL) -ACETYLAMINO]-PHENYLCARBAMOYL}-BUTYRIC ACID experimental unknown Details DB07893 PHENYL[1-(N-SUCCINYLAMINO)PENTYL]PHOSPHONATE experimental unknown Details DB07909 (1S,2S,5S)2-(4-GLUTARIDYLBENZYL)-5-PHENYL-1-CYCLOHEXANOL experimental unknown Details DB08289 N-(PARA-GLUTARAMIDOPHENYL-ETHYL)-PIPERIDINIUM-N-OXIDE experimental unknown Details DB08413 METHYL-PHOSPHONIC ACID MONO-(4-NITRO-PHENYL) ESTER experimental unknown Details DB08562 4-(4-STYRYL-PHENYLCARBAMOYL)-BUTYRIC ACID experimental unknown Details DB01851 Tetrabutylammonium Ion experimental unknown Details DB08647 Trazeolide experimental unknown Details