Penton protein

Details

Name
Penton protein
Synonyms
  • CP-P
  • Penton base protein
  • Protein III
Gene Name
Not Available
Organism
HAdV-2
Amino acid sequence
>lcl|BSEQ0011113|Penton protein
MQRAAMYEEGPPPSYESVVSAAPVAAALGSPFDAPLDPPFVPPRYLRPTGGRNSIRYSEL
APLFDTTRVYLVDNKSTDVASLNYQNDHSNFLTTVIQNNDYSPGEASTQTINLDDRSHWG
GDLKTILHTNMPNVNEFMFTNKFKARVMVSRSLTKDKQVELKYEWVEFTLPEGNYSETMT
IDLMNNAIVEHYLKVGRQNGVLESDIGVKFDTRNFRLGFDPVTGLVMPGVYTNEAFHPDI
ILLPGCGVDFTHSRLSNLLGIRKRQPFQEGFRITYDDLEGGNIPALLDVDAYQASLKDDT
EQGGDGAGGGNNSGSGAEENSNAAAAAMQPVEDMNDHAIRGDTFATRAEEKRAEAEAAAE
AAAPAAQPEVEKPQKKPVIKPLTEDSKKRSYNLISNDSTFTQYRSWYLAYNYGDPQTGIR
SWTLLCTPDVTCGSEQVYWSLPDMMQDPVTFRSTSQISNFPVVGAELLPVHSKSFYNDQA
VYSQLIRQFTSLTHVFNRFPENQILARPPAPTITTVSENVPALTDHGTLPLRNSIGGVQR
VTITDARRRTCPYVYKALGIVSPRVLSSRTF
Number of residues
571
Molecular Weight
63254.24
Theoretical pI
5.07
GO Classification
Functions
structural molecule activity
Processes
clathrin-mediated endocytosis of virus by host cell / virion attachment to host cell
Components
host cell nucleus / T=25 icosahedral viral capsid
General Function
Structural molecule activity
Specific Function
Major capsid protein that self-associates to form penton base pentamers, each in the shape of a pentagon, situated at the 12 vertices of the pseudo T=25 capsid. Involved in virus secondary attachment to host cell after initial attachment by the fiber protein. Binds host integrin heterodimer ITGAV-ITGB5 (alphaV-beta5) thereby triggering clathrin-mediated endocytosis of virions. Mediates initial virus attachment to CXADR-negative cells. Binding to integrins ITGAV-ITGB5 also seems to induce macropinocytosis uptake of the virus. As the virus enters the host cell, penton proteins are shed concomitant with virion acidification in the endosome.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Virion
Gene sequence
>lcl|BSEQ0011114|Penton protein
ATGCAGCGCGCGGCGATGTATGAGGAAGGTCCTCCTCCCTCCTACGAGAGCGTGGTGAGC
GCGGCGCCAGTGGCGGCGGCGCTGGGTTCCCCCTTCGATGCTCCCCTGGACCCGCCGTTT
GTGCCTCCGCGGTACCTGCGGCCTACCGGGGGGAGAAACAGCATCCGTTACTCTGAGTTG
GCACCCCTATTCGACACCACCCGTGTGTACCTTGTGGACAACAAGTCAACGGATGTGGCA
TCCCTGAACTACCAGAACGACCACAGCAACTTTCTAACCACGGTCATTCAAAACAATGAC
TACAGCCCGGGGGAGGCAAGCACACAGACCATCAATCTTGACGACCGTTCGCACTGGGGC
GGCGACCTGAAAACCATCCTGCATACCAACATGCCAAATGTGAACGAGTTCATGTTTACC
AATAAGTTTAAGGCGCGGGTGATGGTGTCGCGCTCGCTTACTAAGGACAAACAGGTGGAG
CTGAAATATGAGTGGGTGGAGTTCACGCTGCCCGAGGGCAACTACTCCGAGACCATGACC
ATAGACCTTATGAACAACGCGATCGTGGAGCACTACTTGAAAGTGGGCAGGCAGAACGGG
GTTCTGGAAAGCGACATCGGGGTAAAGTTTGACACCCGCAACTTCAGACTGGGGTTTGAC
CCAGTCACTGGTCTTGTCATGCCTGGGGTATATACAAACGAAGCCTTCCATCCAGACATC
ATTTTGCTGCCAGGATGCGGGGTGGACTTCACCCACAGCCGCCTGAGCAACTTGTTGGGC
ATCCGCAAGCGGCAACCCTTCCAGGAGGGCTTTAGGATCACCTACGATGACCTGGAGGGT
GGTAACATTCCCGCACTGTTGGATGTGGACGCCTACCAGGCAAGCTTAAAAGATGACACC
GAACAGGGCGGGGATGGCGCAGGCGGCGGCAACAACAGTGGCAGCGGCGCGGAAGAGAAC
TCCAACGCGGCAGCCGCGGCAATGCAGCCGGTGGAGGACATGAACGATCATGCCATTCGC
GGCGACACCTTTGCCACACGGGCGGAGGAGAAGCGCGCTGAGGCCGAGGCAGCGGCAGAA
GCTGCCGCCCCCGCTGCGCAACCCGAGGTCGAGAAGCCTCAGAAGAAACCGGTGATCAAA
CCCCTGACAGAGGACAGCAAGAAACGCAGTTACAACCTAATAAGCAATGACAGCACCTTC
ACCCAGTACCGCAGCTGGTACCTTGCATACAACTACGGCGACCCTCAGACCGGGATCCGC
TCATGGACCCTCCTTTGCACTCCTGACGTAACCTGCGGCTCGGAGCAGGTCTACTGGTCG
TTGCCAGACATGATGCAAGACCCCGTGACCTTCCGCTCCACGAGCCAGATCAGCAACTTT
CCGGTGGTGGGCGCCGAGCTGTTGCCCGTGCACTCCAAGAGCTTCTACAACGACCAGGCC
GTCTACTCCCAGCTCATCCGCCAGTTTACCTCTCTGACCCACGTGTTCAATCGCTTTCCC
GAGAACCAGATTTTGGCGCGCCCGCCAGCCCCCACCATCACCACCGTCAGTGAAAACGTT
CCTGCTCTCACAGATCACGGGACGCTACCGCTGCGCAACAGCATCGGAGGAGTCCAGCGA
GTGACCATTACTGACGCCAGACGCCGCACCTGCCCCTACGTTTACAAGGCCCTGGGCATA
GTCTCGCCGCGCGTCCTATCGAGCCGCACTTTTTGA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP03276
UniProtKB Entry NameCAPSP_ADE02
GenBank Protein ID209827
GenBank Gene IDJ01917
General References
  1. Roberts RJ, O'Neill KE, Yen CT: DNA sequences from the adenovirus 2 genome. J Biol Chem. 1984 Nov 25;259(22):13968-75. [PubMed:6334081]
  2. Alestrom P, Akusjarvi G, Lager M, Yeh-kai L, Pettersson U: Genes encoding the core proteins of adenovirus type 2. J Biol Chem. 1984 Nov 25;259(22):13980-5. [PubMed:6094534]
  3. Bergstrom Lind S, Artemenko KA, Elfineh L, Zhao Y, Bergquist J, Pettersson U: The phosphoproteome of the adenovirus type 2 virion. Virology. 2012 Nov 10;433(1):253-61. doi: 10.1016/j.virol.2012.08.012. Epub 2012 Aug 28. [PubMed:22939182]
  4. van Raaij MJ, Mitraki A, Lavigne G, Cusack S: A triple beta-spiral in the adenovirus fibre shaft reveals a new structural motif for a fibrous protein. Nature. 1999 Oct 28;401(6756):935-8. [PubMed:10553913]
  5. Galinier R, Gout E, Lortat-Jacob H, Wood J, Chroboczek J: Adenovirus protein involved in virus internalization recruits ubiquitin-protein ligases. Biochemistry. 2002 Dec 3;41(48):14299-305. [PubMed:12450395]
  6. Meier O, Boucke K, Hammer SV, Keller S, Stidwill RP, Hemmi S, Greber UF: Adenovirus triggers macropinocytosis and endosomal leakage together with its clathrin-mediated uptake. J Cell Biol. 2002 Sep 16;158(6):1119-31. Epub 2002 Sep 9. [PubMed:12221069]
  7. Lyle C, McCormick F: Integrin alphavbeta5 is a primary receptor for adenovirus in CAR-negative cells. Virol J. 2010 Jul 8;7:148. doi: 10.1186/1743-422X-7-148. [PubMed:20615244]
  8. San Martin C: Latest insights on adenovirus structure and assembly. Viruses. 2012 May;4(5):847-77. doi: 10.3390/v4050847. Epub 2012 May 21. [PubMed:22754652]
  9. Liu H, Jin L, Koh SB, Atanasov I, Schein S, Wu L, Zhou ZH: Atomic structure of human adenovirus by cryo-EM reveals interactions among protein networks. Science. 2010 Aug 27;329(5995):1038-43. doi: 10.1126/science.1187433. [PubMed:20798312]
  10. Zubieta C, Schoehn G, Chroboczek J, Cusack S: The structure of the human adenovirus 2 penton. Mol Cell. 2005 Jan 7;17(1):121-35. [PubMed:15629723]
  11. Fabry CM, Rosa-Calatrava M, Conway JF, Zubieta C, Cusack S, Ruigrok RW, Schoehn G: A quasi-atomic model of human adenovirus type 5 capsid. EMBO J. 2005 May 4;24(9):1645-54. Epub 2005 Apr 21. [PubMed:15861131]
  12. Zubieta C, Blanchoin L, Cusack S: Structural and biochemical characterization of a human adenovirus 2/12 penton base chimera. FEBS J. 2006 Sep;273(18):4336-45. [PubMed:16939624]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB02643N-Dodecyl-N,N-Dimethyl-3-Ammonio-1-PropanesulfonateexperimentalunknownDetails