Kallikrein-1

Details

Name
Kallikrein-1
Synonyms
  • 3.4.21.35
  • Kidney/pancreas/salivary gland kallikrein
  • Tissue kallikrein
Gene Name
KLK1
Organism
Humans
Amino acid sequence
>lcl|BSEQ0037122|Kallikrein-1
MWFLVLCLALSLGGTGAAPPIQSRIVGGWECEQHSQPWQAALYHFSTFQCGGILVHRQWV
LTAAHCISDNYQLWLGRHNLFDDENTAQFVHVSESFPHPGFNMSLLENHTRQADEDYSHD
LMLLRLTEPADTITDAVKVVELPTEEPEVGSTCLASGWGSIEPENFSFPDDLQCVDLKIL
PNDECKKAHVQKVTDFMLCVGHLEGGKDTCVGDSGGPLMCDGVLQGVTSWGYVPCGTPNK
PSVAVRVLSYVKWIEDTIAENS
Number of residues
262
Molecular Weight
28889.425
Theoretical pI
4.39
GO Classification
Functions
serine-type endopeptidase activity
Processes
acute inflammatory response / regulation of systemic arterial blood pressure / zymogen activation
Components
extracellular exosome / extracellular space / nucleus / secretory granule
General Function
Serine-type endopeptidase activity
Specific Function
Glandular kallikreins cleave Met-Lys and Arg-Ser bonds in kininogen to release Lys-bradykinin.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Cytoplasmic
Gene sequence
>lcl|BSEQ0010764|Kallikrein-1 (KLK1)
ATGTGGTTCCTGGTTCTGTGCCTCGCCCTGTCCCTGGGGGGGACTGGTGCTGCGCCCCCG
ATTCAGTCCCGGATTGTGGGAGGCTGGGAGTGTGAGCAGCATTCCCAGCCCTGGCAGGCG
GCTCTGTACCATTTCAGCACTTTCCAGTGTGGGGGCATCCTGGTGCACCGCCAGTGGGTG
CTCACAGCTGCTCATTGCATCAGCGACAATTACCAGCTCTGGCTGGGTCGCCACAACTTG
TTTGACGACGAAAACACAGCCCAGTTTGTTCATGTCAGTGAGAGCTTCCCACACCCTGGC
TTCAACATGAGCCTCCTGGAGAACCACACCCGCCAAGCAGACGAGGACTACAGCCACGAC
CTCATGCTGCTCCGCCTGACAGAGCCTGCTGATACCATCACAGATGCTGTGAAGGTCGTG
GAGTTGCCCACCGAGGAACCCGAAGTGGGGAGCACCTGTTTGGCTTCCGGCTGGGGCAGC
ATCGAACCAGAGAATTTCTCATTTCCAGATGATCTCCAGTGTGTGGACCTCAAAATCCTG
CCTAATGATGAGTGCAAAAAAGCCCACGTCCAGAAGGTGACAGACTTCATGCTGTGTGTC
GGACACCTGGAAGGTGGCAAAGACACCTGTGTGGGTGATTCAGGGGGCCCGCTGATGTGT
GATGGTGTGCTCCAAGGTGTCACATCATGGGGCTACGTCCCTTGTGGCACCCCCAATAAG
CCTTCTGTCGCCGTCAGAGTGCTGTCTTATGTGAAGTGGATCGAGGACACCATAGCGGAG
AACTCCTGA
Chromosome Location
19
Locus
19q13.3
External Identifiers
ResourceLink
UniProtKB IDP06870
UniProtKB Entry NameKLK1_HUMAN
GenBank Protein ID186653
GenBank Gene IDM25629
GenAtlas IDKLK1
HGNC IDHGNC:6357
General References
  1. Fukushima D, Kitamura N, Nakanishi S: Nucleotide sequence of cloned cDNA for human pancreatic kallikrein. Biochemistry. 1985 Dec 31;24(27):8037-43. [PubMed:3004571]
  2. Evans BA, Yun ZX, Close JA, Tregear GW, Kitamura N, Nakanishi S, Callen DF, Baker E, Hyland VJ, Sutherland GR, et al.: Structure and chromosomal localization of the human renal kallikrein gene. Biochemistry. 1988 May 3;27(9):3124-9. [PubMed:2898948]
  3. Angermann A, Bergmann C, Appelhans H: Cloning and expression of human salivary-gland kallikrein in Escherichia coli. Biochem J. 1989 Sep 15;262(3):787-93. [PubMed:2686621]
  4. Chen LM, Murray SR, Chai KX, Chao L, Chao J: Molecular cloning and characterization of a novel kallikrein transcript in colon and its distribution in human tissues. Braz J Med Biol Res. 1994 Aug;27(8):1829-38. [PubMed:7749372]
  5. Yousef GM, Chang A, Scorilas A, Diamandis EP: Genomic organization of the human kallikrein gene family on chromosome 19q13.3-q13.4. Biochem Biophys Res Commun. 2000 Sep 16;276(1):125-33. [PubMed:11006094]
  6. Gan L, Lee I, Smith R, Argonza-Barrett R, Lei H, McCuaig J, Moss P, Paeper B, Wang K: Sequencing and expression analysis of the serine protease gene cluster located in chromosome 19q13 region. Gene. 2000 Oct 17;257(1):119-30. [PubMed:11054574]
  7. Grimwood J, Gordon LA, Olsen A, Terry A, Schmutz J, Lamerdin J, Hellsten U, Goodstein D, Couronne O, Tran-Gyamfi M, Aerts A, Altherr M, Ashworth L, Bajorek E, Black S, Branscomb E, Caenepeel S, Carrano A, Caoile C, Chan YM, Christensen M, Cleland CA, Copeland A, Dalin E, Dehal P, Denys M, Detter JC, Escobar J, Flowers D, Fotopulos D, Garcia C, Georgescu AM, Glavina T, Gomez M, Gonzales E, Groza M, Hammon N, Hawkins T, Haydu L, Ho I, Huang W, Israni S, Jett J, Kadner K, Kimball H, Kobayashi A, Larionov V, Leem SH, Lopez F, Lou Y, Lowry S, Malfatti S, Martinez D, McCready P, Medina C, Morgan J, Nelson K, Nolan M, Ovcharenko I, Pitluck S, Pollard M, Popkie AP, Predki P, Quan G, Ramirez L, Rash S, Retterer J, Rodriguez A, Rogers S, Salamov A, Salazar A, She X, Smith D, Slezak T, Solovyev V, Thayer N, Tice H, Tsai M, Ustaszewska A, Vo N, Wagner M, Wheeler J, Wu K, Xie G, Yang J, Dubchak I, Furey TS, DeJong P, Dickson M, Gordon D, Eichler EE, Pennacchio LA, Richardson P, Stubbs L, Rokhsar DS, Myers RM, Rubin EM, Lucas SM: The DNA sequence and biology of human chromosome 19. Nature. 2004 Apr 1;428(6982):529-35. [PubMed:15057824]
  8. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  9. Baker AR, Shine J: Human kidney kallikrein: cDNA cloning and sequence analysis. DNA. 1985 Dec;4(6):445-50. [PubMed:3853975]
  10. Kellermann J, Lottspeich F, Geiger R, Deutzmann R: Human urinary kallikrein--amino acid sequence and carbohydrate attachment sites. Protein Seq Data Anal. 1988 Feb;1(3):177-82. [PubMed:3163150]
  11. Lu HS, Lin FK, Chao L, Chao J: Human urinary kallikrein. Complete amino acid sequence and sites of glycosylation. Int J Pept Protein Res. 1989 Apr;33(4):237-49. [PubMed:2666327]
  12. Lottspeich F, Geiger R, Henschen A, Kutzbach C: N-Terminal amino acid sequence of human urinary kallikrein homology with other serine proteases. Hoppe Seylers Z Physiol Chem. 1979 Dec;360(12):1947-50. [PubMed:393608]
  13. Takahashi S, Irie A, Katayama Y, Ito K, Miyake Y: N-terminal amino acid sequence of human urinary prokallikrein. J Biochem. 1986 Mar;99(3):989-92. [PubMed:3635530]
  14. Laxmikanthan G, Blaber SI, Bernett MJ, Scarisbrick IA, Juliano MA, Blaber M: 1.70 A X-ray structure of human apo kallikrein 1: structural changes upon peptide inhibitor/substrate binding. Proteins. 2005 Mar 1;58(4):802-14. [PubMed:15651049]
  15. Slim R, Torremocha F, Moreau T, Pizard A, Hunt SC, Vuagnat A, Williams GH, Gauthier F, Jeunemaitre X, Alhenc-Gelas F: Loss-of-function polymorphism of the human kallikrein gene with reduced urinary kallikrein activity. J Am Soc Nephrol. 2002 Apr;13(4):968-76. [PubMed:11912256]
  16. Azizi M, Boutouyrie P, Bissery A, Agharazii M, Verbeke F, Stern N, Bura-Riviere A, Laurent S, Alhenc-Gelas F, Jeunemaitre X: Arterial and renal consequences of partial genetic deficiency in tissue kallikrein activity in humans. J Clin Invest. 2005 Mar;115(3):780-7. [PubMed:15765151]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB06245LanoteplaseinvestigationalunknownDetails
DB06692Aprotininapproved, investigational, withdrawnunknownDetails
DB12598NafamostatinvestigationalyesinhibitorDetails
DB06728AnilineexperimentalunknownDetails
DB03127BenzamidineexperimentalunknownDetails
DB01370Aluminiumapproved, investigationalunknowninhibitorDetails
DB14517Aluminium phosphateapproved, investigationalunknownDetails
DB14518Aluminum acetateapproved, investigationalunknownDetails