NH(3)-dependent NAD(+) synthetase

Details

Name
NH(3)-dependent NAD(+) synthetase
Synonyms
  • 6.3.1.5
  • General stress protein 38
  • GSP38
  • outB
  • Spore outgrowth factor B
  • Sporulation protein OutB
Gene Name
nadE
Organism
Bacillus subtilis (strain 168)
Amino acid sequence
>lcl|BSEQ0016488|NH(3)-dependent NAD(+) synthetase
MSMQEKIMRELHVKPSIDPKQEIEDRVNFLKQYVKKTGAKGFVLGISGGQDSTLAGRLAQ
LAVESIREEGGDAQFIAVRLPHGTQQDEDDAQLALKFIKPDKSWKFDIKSTVSAFSDQYQ
QETGDQLTDFNKGNVKARTRMIAQYAIGGQEGLLVLGTDHAAEAVTGFFTKYGDGGADLL
PLTGLTKRQGRTLLKELGAPERLYLKEPTADLLDEKPQQSDETELGISYDEIDDYLEGKE
VSAKVSEALEKRYSMTEHKRQVPASMFDDWWK
Number of residues
272
Molecular Weight
30394.995
Theoretical pI
4.83
GO Classification
Functions
ATP binding / NAD+ synthase (glutamine-hydrolyzing) activity / NAD+ synthase activity
Processes
NAD biosynthetic process / sporulation resulting in formation of a cellular spore
General Function
Nad+ synthase activity
Specific Function
Catalyzes a key step in NAD biosynthesis, transforming deamido-NAD into NAD by a two-step reaction.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Not Available
Gene sequence
>lcl|BSEQ0016489|NH(3)-dependent NAD(+) synthetase (nadE)
ATGAGCATGCAGGAAAAGATTATGCGTGAGTTACATGTGAAGCCCTCAATTGATCCAAAG
CAAGAAATTGAGGACCGAGTCAATTTTTTAAAACAATATGTAAAGAAAACCGGTGCTAAA
GGCTTTGTATTGGGAATCAGCGGGGGCCAGGATTCAACACTTGCGGGAAGACTCGCTCAG
CTTGCGGTGGAGAGCATTCGCGAGGAGGGCGGAGACGCTCAATTTATCGCGGTCCGTCTT
CCGCATGGCACACAGCAGGATGAAGACGATGCCCAGCTTGCTTTGAAGTTTATTAAGCCG
GATAAATCATGGAAGTTTGATATTAAATCGACAGTCAGCGCTTTTTCTGATCAGTATCAG
CAGGAAACAGGCGATCAGCTGACGGACTTTAATAAAGGAAACGTAAAAGCAAGAACAAGA
ATGATCGCGCAATACGCGATCGGCGGCCAGGAAGGTCTTCTTGTGTTAGGAACAGACCAT
GCTGCTGAAGCAGTGACTGGTTTCTTTACGAAGTACGGTGACGGCGGAGCAGACCTCCTG
CCGCTGACAGGCTTGACGAAGCGCCAGGGAAGAACCTTGCTGAAAGAGCTGGGTGCACCG
GAACGCTTATACTTAAAAGAACCGACTGCCGATCTGCTCGACGAAAAACCGCAGCAGTCG
GATGAAACAGAGCTTGGCATTTCCTACGACGAGATTGACGATTATCTCGAAGGAAAAGAA
GTATCAGCGAAAGTATCAGAAGCGCTGGAAAAACGCTACAGCATGACTGAACATAAACGC
CAGGTTCCGGCGTCTATGTTTGATGACTGGTGGAAATAA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP08164
UniProtKB Entry NameNADE_BACSU
GenBank Protein ID143279
GenBank Gene IDM15811
General References
  1. Albertini AM, Caramori T, Henner D, Ferrari E, Galizzi A: Nucleotide sequence of the outB locus of Bacillus subtilis and regulation of its expression. J Bacteriol. 1987 Apr;169(4):1480-4. [PubMed:2435704]
  2. Yamane K, Kumano M, Kurita K: The 25 degrees-36 degrees region of the Bacillus subtilis chromosome: determination of the sequence of a 146 kb segment and identification of 113 genes. Microbiology. 1996 Nov;142 ( Pt 11):3047-56. [PubMed:8969502]
  3. Kunst F, Ogasawara N, Moszer I, Albertini AM, Alloni G, Azevedo V, Bertero MG, Bessieres P, Bolotin A, Borchert S, Borriss R, Boursier L, Brans A, Braun M, Brignell SC, Bron S, Brouillet S, Bruschi CV, Caldwell B, Capuano V, Carter NM, Choi SK, Cordani JJ, Connerton IF, Cummings NJ, Daniel RA, Denziot F, Devine KM, Dusterhoft A, Ehrlich SD, Emmerson PT, Entian KD, Errington J, Fabret C, Ferrari E, Foulger D, Fritz C, Fujita M, Fujita Y, Fuma S, Galizzi A, Galleron N, Ghim SY, Glaser P, Goffeau A, Golightly EJ, Grandi G, Guiseppi G, Guy BJ, Haga K, Haiech J, Harwood CR, Henaut A, Hilbert H, Holsappel S, Hosono S, Hullo MF, Itaya M, Jones L, Joris B, Karamata D, Kasahara Y, Klaerr-Blanchard M, Klein C, Kobayashi Y, Koetter P, Koningstein G, Krogh S, Kumano M, Kurita K, Lapidus A, Lardinois S, Lauber J, Lazarevic V, Lee SM, Levine A, Liu H, Masuda S, Mauel C, Medigue C, Medina N, Mellado RP, Mizuno M, Moestl D, Nakai S, Noback M, Noone D, O'Reilly M, Ogawa K, Ogiwara A, Oudega B, Park SH, Parro V, Pohl TM, Portelle D, Porwollik S, Prescott AM, Presecan E, Pujic P, Purnelle B, Rapoport G, Rey M, Reynolds S, Rieger M, Rivolta C, Rocha E, Roche B, Rose M, Sadaie Y, Sato T, Scanlan E, Schleich S, Schroeter R, Scoffone F, Sekiguchi J, Sekowska A, Seror SJ, Serror P, Shin BS, Soldo B, Sorokin A, Tacconi E, Takagi T, Takahashi H, Takemaru K, Takeuchi M, Tamakoshi A, Tanaka T, Terpstra P, Togoni A, Tosato V, Uchiyama S, Vandebol M, Vannier F, Vassarotti A, Viari A, Wambutt R, Wedler H, Weitzenegger T, Winters P, Wipat A, Yamamoto H, Yamane K, Yasumoto K, Yata K, Yoshida K, Yoshikawa HF, Zumstein E, Yoshikawa H, Danchin A: The complete genome sequence of the gram-positive bacterium Bacillus subtilis. Nature. 1997 Nov 20;390(6657):249-56. [PubMed:9384377]
  4. Antelmann H, Bernhardt J, Schmid R, Mach H, Volker U, Hecker M: First steps from a two-dimensional protein index towards a response-regulation map for Bacillus subtilis. Electrophoresis. 1997 Aug;18(8):1451-63. [PubMed:9298659]
  5. Mitchell C, Morris PW, Vary JC: Identification of proteins phosphorylated by ATP during sporulation of Bacillus subtilis. J Bacteriol. 1992 Apr;174(8):2474-7. [PubMed:1556067]
  6. Albertini AM, Galizzi A: The Bacillus subtilis outB gene is highly homologous to an Escherichia coli ntr-like gene. J Bacteriol. 1990 Sep;172(9):5482-5. [PubMed:2118513]
  7. Nessi C, Albertini AM, Speranza ML, Galizzi A: The outB gene of Bacillus subtilis codes for NAD synthetase. J Biol Chem. 1995 Mar 17;270(11):6181-5. [PubMed:7890752]
  8. Rizzi M, Nessi C, Mattevi A, Coda A, Bolognesi M, Galizzi A: Crystal structure of NH3-dependent NAD+ synthetase from Bacillus subtilis. EMBO J. 1996 Oct 1;15(19):5125-34. [PubMed:8895556]
  9. Rizzi M, Bolognesi M, Coda A: A novel deamido-NAD+-binding site revealed by the trapped NAD-adenylate intermediate in the NAD+ synthetase structure. Structure. 1998 Sep 15;6(9):1129-40. [PubMed:9753692]
  10. Devedjiev Y, Symersky J, Singh R, Jedrzejas M, Brouillette C, Brouillette W, Muccio D, Chattopadhyay D, DeLucas L: Stabilization of active-site loops in NH3-dependent NAD+ synthetase from Bacillus subtilis. Acta Crystallogr D Biol Crystallogr. 2001 Jun;57(Pt 6):806-12. Epub 2001 May 25. [PubMed:11375500]
  11. Symersky J, Devedjiev Y, Moore K, Brouillette C, DeLucas L: NH3-dependent NAD+ synthetase from Bacillus subtilis at 1 A resolution. Acta Crystallogr D Biol Crystallogr. 2002 Jul;58(Pt 7):1138-46. Epub 2002 Jun 20. [PubMed:12077433]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB02596alpha,beta-Methyleneadenosine 5'-triphosphateexperimentalunknownDetails
DB04099Deamido-Nad+experimentalunknownDetails
DB00798Gentamicinapproved, vet_approvedunknownDetails