Inhibin beta A chain

Details

Name

Inhibin beta A chain

Synonyms

• Activin beta-A chain
• EDF
• Erythroid differentiation protein

Gene Name

INHBA

Organism

Humans

Amino acid sequence

>lcl|BSEQ0052688|Inhibin beta A chain
MPLLWLRGFLLASCWIIVRSSPTPGSEGHSAAPDCPSCALAALPKDVPNSQPEMVEAVKK
HILNMLHLKKRPDVTQPVPKAALLNAIRKLHVGKVGENGYVEIEDDIGRRAEMNELMEQT
SEIITFAESGTARKTLHFEISKEGSDLSVVERAEVWLFLKVPKANRTRTKVTIRLFQQQK
HPQGSLDTGEEAEEVGLKGERSELLLSEKVVDARKSTWHVFPVSSSIQRLLDQGKSSLDV
RIACEQCQESGASLVLLGKKKKKEEEGEGKKKGGGEGGAGADEEKEQSHRPFLMLQARQS
EDHPHRRRRRGLECDGKVNICCKKQFFVSFKDIGWNDWIIAPSGYHANYCEGECPSHIAG
TSGSSLSFHSTVINHYRMRGHSPFANLKSCCVPTKLRPMSMLYYDDGQNIIKKDIQNMIV
EECGCS

Number of residues

426

Molecular Weight

47441.915

Theoretical pI

Not Available

GO Classification

Functions

cytokine activity / growth factor activity / hormone activity / identical protein binding / inhibin binding / peptide hormone binding / protein-containing complex binding / type II activin receptor binding

Processes

activin receptor signaling pathway / cell differentiation / cell surface receptor signaling pathway / cell-cell signaling / cellular response to cholesterol / cellular response to follicle-stimulating hormone stimulus / defense response / endodermal cell differentiation / erythrocyte differentiation / extrinsic apoptotic signaling pathway / eyelid development in camera-type eye / G1/S transition of mitotic cell cycle / GABAergic neuron differentiation / hair follicle development / hematopoietic progenitor cell differentiation / hemoglobin biosynthetic process / male gonad development / mesodermal cell differentiation / negative regulation of B cell differentiation / negative regulation of cell cycle / negative regulation of cell growth / negative regulation of cell population proliferation / negative regulation of follicle-stimulating hormone secretion / negative regulation of interferon-gamma production / negative regulation of macrophage differentiation / negative regulation of phosphorylation / nervous system development / odontogenesis / ovarian follicle development / positive regulation of cellular protein metabolic process / positive regulation of erythrocyte differentiation / positive regulation of extrinsic apoptotic signaling pathway in absence of ligand / positive regulation of follicle-stimulating hormone secretion / positive regulation of gene expression / positive regulation of ovulation / positive regulation of pathway-restricted SMAD protein phosphorylation / positive regulation of transcription by RNA polymerase II / positive regulation of transcription, DNA-templated / progesterone secretion / regulation of cell cycle / regulation of follicle-stimulating hormone secretion / regulation of transcription by RNA polymerase II / response to drug / roof of mouth development / SMAD protein signal transduction / striatal medium spiny neuron differentiation

Components

activin A complex / extracellular region / extracellular space / inhibin A complex / perinuclear region of cytoplasm

General Function

Inhibins and activins inhibit and activate, respectively, the secretion of follitropin by the pituitary gland. Inhibins/activins are involved in regulating a number of diverse functions such as hypothalamic and pituitary hormone secretion, gonadal hormone secretion, germ cell development and maturation, erythroid differentiation, insulin secretion, nerve cell survival, embryonic axial development or bone growth, depending on their subunit composition. Inhibins appear to oppose the functions of activins.

Specific Function

Cytokine activity

Pfam Domain Function

• TGF_beta (PF00019)
• TGFb_propeptide (PF00688)

Transmembrane Regions

Not Available

Cellular Location

Secreted

Gene sequence

>lcl|BSEQ0052689|Inhibin beta A chain (INHBA)
ATGCCCTTGCTTTGGCTGAGAGGATTTCTGTTGGCAAGTTGCTGGATTATAGTGAGGAGT
TCCCCCACCCCAGGATCCGAGGGGCACAGCGCGGCCCCCGACTGTCCGTCCTGTGCGCTG
GCCGCCCTCCCAAAGGATGTACCCAACTCTCAGCCAGAGATGGTGGAGGCCGTCAAGAAG
CACATTTTAAACATGCTGCACTTGAAGAAGAGACCCGATGTCACCCAGCCGGTACCCAAG
GCGGCGCTTCTGAACGCGATCAGAAAGCTTCATGTGGGCAAAGTCGGGGAGAACGGGTAT
GTGGAGATAGAGGATGACATTGGAAGGAGGGCAGAAATGAATGAACTTATGGAGCAGACC
TCGGAGATCATCACGTTTGCCGAGTCAGGAACAGCCAGGAAGACGCTGCACTTCGAGATT
TCCAAGGAAGGCAGTGACCTGTCAGTGGTGGAGCGTGCAGAAGTCTGGCTCTTCCTAAAA
GTCCCCAAGGCCAACAGGACCAGGACCAAAGTCACCATCCGCCTCTTCCAGCAGCAGAAG
CACCCGCAGGGCAGCTTGGACACAGGGGAAGAGGCCGAGGAAGTGGGCTTAAAGGGGGAG
AGGAGTGAACTGTTGCTCTCTGAAAAAGTAGTAGACGCTCGGAAGAGCACCTGGCATGTC
TTCCCTGTCTCCAGCAGCATCCAGCGGTTGCTGGACCAGGGCAAGAGCTCCCTGGACGTT
CGGATTGCCTGTGAGCAGTGCCAGGAGAGTGGCGCCAGCTTGGTTCTCCTGGGCAAGAAG
AAGAAGAAAGAAGAGGAGGGGGAAGGGAAAAAGAAGGGCGGAGGTGAAGGTGGGGCAGGA
GCAGATGAGGAAAAGGAGCAGTCGCACAGACCTTTCCTCATGCTGCAGGCCCGGCAGTCT
GAAGACCACCCTCATCGCCGGCGTCGGCGGGGCTTGGAGTGTGATGGCAAGGTCAACATC
TGCTGTAAGAAACAGTTCTTTGTCAGTTTCAAGGACATCGGCTGGAATGACTGGATCATT
GCTCCCTCTGGCTATCATGCCAACTACTGCGAGGGTGAGTGCCCGAGCCATATAGCAGGC
ACGTCCGGGTCCTCACTGTCCTTCCACTCAACAGTCATCAACCACTACCGCATGCGGGGC
CATAGCCCCTTTGCCAACCTCAAATCGTGCTGTGTGCCCACCAAGCTGAGACCCATGTCC
ATGTTGTACTATGATGATGGTCAAAACATCATCAAAAAGGACATTCAGAACATGATCGTG
GAGGAGTGTGGGTGCTCATAG

Chromosome Location

7

Locus

7p14.1

External Identifiers

Resource	Link
UniProtKB ID	P08476
UniProtKB Entry Name	INHBA_HUMAN
HGNC ID	HGNC:6066

General References

1. Mason AJ, Niall HD, Seeburg PH: Structure of two human ovarian inhibins. Biochem Biophys Res Commun. 1986 Mar 28;135(3):957-64. doi: 10.1016/0006-291x(86)91021-1. [Article]
2. Murata M, Eto Y, Shibai H, Sakai M, Muramatsu M: Erythroid differentiation factor is encoded by the same mRNA as that of the inhibin beta A chain. Proc Natl Acad Sci U S A. 1988 Apr;85(8):2434-8. doi: 10.1073/pnas.85.8.2434. [Article]
3. Tanimoto K, Handa S, Ueno N, Murakami K, Fukamizu A: Structure and sequence analysis of the human activin beta A subunit gene. DNA Seq. 1991;2(2):103-10. doi: 10.3109/10425179109039678. [Article]
4. Hillier LW, Fulton RS, Fulton LA, Graves TA, Pepin KH, Wagner-McPherson C, Layman D, Maas J, Jaeger S, Walker R, Wylie K, Sekhon M, Becker MC, O'Laughlin MD, Schaller ME, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Cordes M, Du H, Sun H, Edwards J, Bradshaw-Cordum H, Ali J, Andrews S, Isak A, Vanbrunt A, Nguyen C, Du F, Lamar B, Courtney L, Kalicki J, Ozersky P, Bielicki L, Scott K, Holmes A, Harkins R, Harris A, Strong CM, Hou S, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Leonard S, Rohlfing T, Rock SM, Tin-Wollam AM, Abbott A, Minx P, Maupin R, Strowmatt C, Latreille P, Miller N, Johnson D, Murray J, Woessner JP, Wendl MC, Yang SP, Schultz BR, Wallis JW, Spieth J, Bieri TA, Nelson JO, Berkowicz N, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Bedell JA, Mardis ER, Clifton SW, Chissoe SL, Marra MA, Raymond C, Haugen E, Gillett W, Zhou Y, James R, Phelps K, Iadanoto S, Bubb K, Simms E, Levy R, Clendenning J, Kaul R, Kent WJ, Furey TS, Baertsch RA, Brent MR, Keibler E, Flicek P, Bork P, Suyama M, Bailey JA, Portnoy ME, Torrents D, Chinwalla AT, Gish WR, Eddy SR, McPherson JD, Olson MV, Eichler EE, Green ED, Waterston RH, Wilson RK: The DNA sequence of human chromosome 7. Nature. 2003 Jul 10;424(6945):157-64. [Article]
5. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
6. Stewart AG, Milborrow HM, Ring JM, Crowther CE, Forage RG: Human inhibin genes. Genomic characterisation and sequencing. FEBS Lett. 1986 Oct 6;206(2):329-34. doi: 10.1016/0014-5793(86)81006-7. [Article]
7. Schneyer A, Schoen A, Quigg A, Sidis Y: Differential binding and neutralization of activins A and B by follistatin and follistatin like-3 (FSTL-3/FSRP/FLRG). Endocrinology. 2003 May;144(5):1671-4. doi: 10.1210/en.2002-0203. [Article]
8. Thompson TB, Woodruff TK, Jardetzky TS: Structures of an ActRIIB:activin A complex reveal a novel binding mode for TGF-beta ligand:receptor interactions. EMBO J. 2003 Apr 1;22(7):1555-66. doi: 10.1093/emboj/cdg156. [Article]
9. Stamler R, Keutmann HT, Sidis Y, Kattamuri C, Schneyer A, Thompson TB: The structure of FSTL3.activin A complex. Differential binding of N-terminal domains influences follistatin-type antagonist specificity. J Biol Chem. 2008 Nov 21;283(47):32831-8. doi: 10.1074/jbc.M801266200. Epub 2008 Sep 2. [Article]
10. Tournier I, Marlin R, Walton K, Charbonnier F, Coutant S, Thery JC, Charbonnier C, Spurrell C, Vezain M, Ippolito L, Bougeard G, Roman H, Tinat J, Sabourin JC, Stoppa-Lyonnet D, Caron O, Bressac-de Paillerets B, Vaur D, King MC, Harrison C, Frebourg T: Germline mutations of inhibins in early-onset ovarian epithelial tumors. Hum Mutat. 2014 Mar;35(3):294-7. doi: 10.1002/humu.22489. Epub 2013 Dec 27. [Article]

Drug Relations

Drug Relations

DrugBank ID	Name	Drug group	Pharmacological action?	Actions	Details
DB16379	Garetosmab	investigational	yes	binder	Details