Protein ArsC
Details
- Name
- Protein ArsC
- Synonyms
- Arsenate reductase
- Arsenical pump modifier
- Low molecular weight protein-tyrosine-phosphatase
- Gene Name
- arsC
- Organism
- Staphylococcus aureus
- Amino acid sequence
>lcl|BSEQ0011344|Protein ArsC MDKKTIYFICTGNSCRSQMAEGWGKEILGEGWNVYSAGIETHGVNPKAIEAMKEVDIDIS NHTSDLIDNDILKQSDLVVTLCSDADNNCPILPPNVKKEHWGFDDPAGKEWSEFQRVRDE IKLAIEKFKLR
- Number of residues
- 131
- Molecular Weight
- 14812.62
- Theoretical pI
- 4.68
- GO Classification
- Functionsarsenate reductase (thioredoxin) activity / protein tyrosine phosphatase activityProcessesresponse to arsenic-containing substance
- General Function
- Protein tyrosine phosphatase activity
- Specific Function
- Reduces arsenate [As(V)] to arsenite [As(III)] and dephosphorylates tyrosine phosphorylated proteins, low-MW aryl phosphates and natural and synthetic acyl phosphates. Could switch between different functions in different circumstances.
- Pfam Domain Function
- LMWPc (PF01451)
- Transmembrane Regions
- Not Available
- Cellular Location
- Cytoplasm
- Gene sequence
>lcl|BSEQ0011345|Protein ArsC (arsC) ATGGATAAGAAAACAATTTATTTTATATGTACAGGAAACTCTTGTCGTAGCCAAATGGCT GAAGGTTGGGGAAAGGAAATATTGGGTGAAGGTTGGAATGTCTATTCTGCTGGTATTGAA ACACATGGTGTTAATCCTAAAGCAATAGAAGCTATGAAAGAAGTAGATATTGATATATCA AACCATACGTCAGACTTGATTGATAATGATATTTTAAAACAATCAGATTTGGTCGTAACG TTATGTAGTGATGCAGACAATAATTGTCCTATTTTACCACCAAACGTTAAAAAAGAGCAT TGGGGTTTTGATGATCCAGCAGGTAAAGAATGGTCAGAATTCCAACGTGTTAGAGACGAG ATTAAATTAGCTATAGAAAAGTTTAAATTGAGATAA
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P0A006 UniProtKB Entry Name ARSC_STAAU GenBank Protein ID 150729 GenBank Gene ID M86824 - General References
- Ji G, Silver S: Regulation and expression of the arsenic resistance operon from Staphylococcus aureus plasmid pI258. J Bacteriol. 1992 Jun;174(11):3684-94. [Article]
- Ji G, Silver S: Reduction of arsenate to arsenite by the ArsC protein of the arsenic resistance operon of Staphylococcus aureus plasmid pI258. Proc Natl Acad Sci U S A. 1992 Oct 15;89(20):9474-8. [Article]
- Ji G, Garber EA, Armes LG, Chen CM, Fuchs JA, Silver S: Arsenate reductase of Staphylococcus aureus plasmid pI258. Biochemistry. 1994 Jun 14;33(23):7294-9. [Article]
- Messens J, Hayburn G, Desmyter A, Laus G, Wyns L: The essential catalytic redox couple in arsenate reductase from Staphylococcus aureus. Biochemistry. 1999 Dec 21;38(51):16857-65. [Article]
- Messens J, Martins JC, Brosens E, Van Belle K, Jacobs DM, Willem R, Wyns L: Kinetics and active site dynamics of Staphylococcus aureus arsenate reductase. J Biol Inorg Chem. 2002 Jan;7(1-2):146-56. Epub 2001 Jul 24. [Article]
- Zegers I, Martins JC, Willem R, Wyns L, Messens J: Arsenate reductase from S. aureus plasmid pI258 is a phosphatase drafted for redox duty. Nat Struct Biol. 2001 Oct;8(10):843-7. [Article]
- Messens J, Martins JC, Van Belle K, Brosens E, Desmyter A, De Gieter M, Wieruszeski JM, Willem R, Wyns L, Zegers I: All intermediates of the arsenate reductase mechanism, including an intramolecular dynamic disulfide cascade. Proc Natl Acad Sci U S A. 2002 Jun 25;99(13):8506-11. Epub 2002 Jun 18. [Article]