NAD(P) transhydrogenase subunit beta

Details

Name
NAD(P) transhydrogenase subunit beta
Synonyms
  • 1.6.1.2
  • dIII
  • Nicotinamide nucleotide transhydrogenase subunit beta
  • nntB
  • Proton-translocating transhydrogenase NADP(H)-binding component
  • Pyridine nucleotide transhydrogenase subunit beta
Gene Name
pntB
Organism
Rhodospirillum rubrum
Amino acid sequence
>lcl|BSEQ0011501|NAD(P) transhydrogenase subunit beta
MTHSLTMAAYIVAGVLFILALRGLSNPESARNGNRMGMVGMAIAILTTLLSPSVQAYAWI
VLAIAIGGAIGTVIAKKVLMTALPQLVAAFHSLVGMAAVLVATGALLNPEAYGIGSAGAI
HAGSLVEMSLGLAVGAITFSGSVIAFGKLQGLIAGKPVTFPMQHPLNAVLGILLVVLLVV
FAATESHTAYFALMILAFALGFLLIIPIGGADMPVVISMLNSYSGWAAAGIGFTLGNPLL
IIAGALVGSSGAILSYIMCKGMNRSIFNVILGGFGSEGGVAAAGGAAGDRSVKAGSAEDA
AFIMKNASKVIIVPGYGMAVAQAQHALREMADVLKKEGVEVSYAIHPVAGRMPGHMNVLL
AEANVPYDEVFELEEINSSFQTADVAFVIGANDVTNPAAKTDPSSPIYGMPILDVEKAGT
VLFIKRSMASGYAGVENELFFRNNTMMLFGDAKKMTEQIVQAMN
Number of residues
464
Molecular Weight
47807.835
Theoretical pI
6.52
GO Classification
Functions
NAD(P)+ transhydrogenase (AB-specific) activity / NADP binding
Processes
oxidation-reduction process
Components
integral component of membrane / plasma membrane
General Function
Nadp binding
Specific Function
The transhydrogenation between NADH and NADP is coupled to respiration and ATP hydrolysis and functions as a proton pump across the membrane.
Pfam Domain Function
Transmembrane Regions
54-74 86-106 126-146 164-184 191-211 227-247
Cellular Location
Cell inner membrane
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP0C188
UniProtKB Entry NamePNTB_RHORU
GenBank Gene IDU01158
General References
  1. Yamaguchi M, Hatefi Y: Energy-transducing nicotinamide nucleotide transhydrogenase: nucleotide sequences of the genes and predicted amino acid sequences of the subunits of the enzyme from Rhodospirillum rubrum. J Bioenerg Biomembr. 1994 Aug;26(4):435-45. [PubMed:7844118]
  2. Jeeves M, Smith KJ, Quirk PG, Cotton NP, Jackson JB: Solution structure of the NADP(H)-binding component (dIII) of proton-translocating transhydrogenase from Rhodospirillum rubrum. Biochim Biophys Acta. 2000 Aug 15;1459(2-3):248-57. [PubMed:11004437]
  3. Cotton NP, White SA, Peake SJ, McSweeney S, Jackson JB: The crystal structure of an asymmetric complex of the two nucleotide binding components of proton-translocating transhydrogenase. Structure. 2001 Feb 7;9(2):165-76. [PubMed:11250201]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB03461Nicotinamide adenine dinucleotide phosphateexperimentalunknownDetails