RNA-directed RNA polymerase lambda-3

Details

Name
RNA-directed RNA polymerase lambda-3
Synonyms
  • 2.7.7.48
  • Lambda3
  • Lambda3(Pol)
Gene Name
L1
Organism
T3D
Amino acid sequence
>lcl|BSEQ0013321|RNA-directed RNA polymerase lambda-3
MSSMILTQFGPFIESISGITDQSNDVFEDAAKAFSMFTRSDVYKALDEIPFSDDAMLPIP
PTIYTKPSHDSYYYIDALNRVRRKTYQGPDDVYVPNCSIVELLEPHETLTSYGRLSEAIE
NRAKDGDSQARIATTYGRIAESQARQIKAPLEKFVLALLVAEAGGSLYDPVLQKYDEIPD
LSHNCPLWCFREICRHISGPLPDRAPYLYLSAGVFWLMSPRMTSAIPPLLSDLVNLAILQ
QTAGLDPSLVKLGVQICLHAAASSSYSWFILKTKSIFPQNTLHSMYESLEGGYCPNLEWL
EPRSDYKFMYMGVMPLSAKYARSAPSNDKKARELGEKYGLSSVVGELRKRTKTYVKHDFA
SVRYIRDAMACTSGIFLVRTPTETVLQEYTQSPEIKVPIPQKDWTGPIGEIRILKDTTSS
IARYLYRTWYLAAARMAAQPRTWDPLFQAIMRSQYVTARGGSGAALRESLYAINVSLPDF
KGLPVKAATKIFQAAQLANLPFSHTSVAILADTSMGLRNQVQRRPRSIMPLNVPQQQVSA
PHTLTADYINYHMNLSPTSGSAVIEKVIPLGVYASSPPNQSINIDISACDASITWDFFLS
VIMAAIHEGVASSSIGKPFMGVPASIVNDESVVGVRAARPISGMQNMIQHLSKLYKRGFS
YRVNDSFSPGNDFTHMTTTFPSGSTATSTEHTANNSTMMETFLTVWGPEHTDDPDVLRLM
KSLTIQRNYVCQGDDGLMIIDGTTAGKVNSETIQNDLELISKYGEEFGWKYDIAYDGTAE
YLKLYFIFGCRIPNLSRHPIVGKERANSSAEEPWPAILDQIMGVFFNGVHDGLQWQRWIR
YSWALCCAFSRQRTMIGESVGYLQYPMWSFVYWGLPLVKAFGSDPWIFSWYMPTGDLGMY
SWISLIRPLMTRWMVANGYVTDRCSTVFGNADYRRCFNELKLYQGYYMAQLPRNPKKSGR
AASREVREQFTQALSDYLMQNPELKSRVLRGRSEWEKYGAGIIHNPPSLFDVPHKWYQGA
QEAAIATREELAEMDETLMRARRHSYSSFSKLLEAYLLVKWRMCEAREPSVDLRLPLCAG
IDPLNSDPFLKMVSVGPMLQSTRKYFAQTLFMAKTVSGLDVNAIDSALLRLRTLGADKKA
LTAQLLMVGLQESEADALAGKIMLQDVNTVQLARVVNLAVPDTWMSLDFDSMFKHHVKLL
PKDGRHLNTDIPPRMGWLRAILRFLGAGMVMTATGVAVDIYLEDIHGGGRSLGQRFMTWM
RQEGRSA
Number of residues
1267
Molecular Weight
142268.83
Theoretical pI
8.02
GO Classification
Functions
hydrolase activity / nucleotide binding / RNA binding / RNA-directed RNA polymerase activity
Processes
viral genome replication
Components
viral nucleocapsid
General Function
Rna-directed rna polymerase activity
Specific Function
RNA-directed RNA polymerase that is involved in transcription and genome replication. Following infection, it catalyzes the synthesis of fully conservative plus strands. After core assembly, which consists in recruitment of one capped plus-strand for each genomic segments and polymerase complexes, the polymerase switches mode and catalyzes the synthesis of complementary minus-strands.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Virion
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP0CK31
UniProtKB Entry NameRDRP_REOVD
GenBank Protein ID499864
GenBank Gene IDM24734
General References
  1. Wiener JR, Joklik WK: The sequences of the reovirus serotype 1, 2, and 3 L1 genome segments and analysis of the mode of divergence of the reovirus serotypes. Virology. 1989 Mar;169(1):194-203. [PubMed:2922925]
  2. Kobayashi T, Antar AA, Boehme KW, Danthi P, Eby EA, Guglielmi KM, Holm GH, Johnson EM, Maginnis MS, Naik S, Skelton WB, Wetzel JD, Wilson GJ, Chappell JD, Dermody TS: A plasmid-based reverse genetics system for animal double-stranded RNA viruses. Cell Host Microbe. 2007 Apr 19;1(2):147-57. [PubMed:18005692]
  3. Tao Y, Farsetta DL, Nibert ML, Harrison SC: RNA synthesis in a cage--structural studies of reovirus polymerase lambda3. Cell. 2002 Nov 27;111(5):733-45. [PubMed:12464184]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB039587-methyl-guanosine-5'-triphosphate-5'-guanosineexperimentalunknownDetails