High-molecular-weight cytochrome c

Details

Name
High-molecular-weight cytochrome c
Synonyms
  • Cytochrome CC3
  • hmc
Gene Name
hmcA
Organism
Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303)
Amino acid sequence
>lcl|BSEQ0003468|High-molecular-weight cytochrome c
MRNGRTLLRWAGVLAATAIIGVGGFWSQGTTKALPEGPGEKRADLIEIGAMERFGKLDLP
KVAFRHDQHTTAVTGMGKDCAACHKSKDGKMSLKFMRLDDNSAAELKEIYHANCIGCHTD
LAKAGKKTGPQDGECRSCHNPKPSAASSWKEIGFDKSLHYRHVASKAIKPVGDPQKNCGA
CHHVYDEASKKLVWGKNKEDSCRACHGEKPVDKRPALDTAAHTACISCHMDVAKTKAETG
PVNCAGCHAPEAQAKFKVVREVPRLDRGQPDAALILPVPGKDAPREMKGTMKPVAFDHKA
HEAKANDCRTCHHVRIDTCTACHTVNGTADSKFVQLEKAMHQPDSMRSCVGCHNTRVQQP
TCAGCHGFIKPTKSDAQCGVCHVAAPGFDAKQVEAGALLNLKAEQRSQVAASMLSARPQP
KGTFDLNDIPEKVVIGSIAKEYQPSEFPHRKIVKTLIAGIGEDKLAATFHIEKGTLCQGC
HHNSPASLTPPKCASCHGKPFDADRGDRPGLKAAYHQQCMGCHDRMKIEKPANTACVDCH
KERAK
Number of residues
545
Molecular Weight
58901.06
Theoretical pI
8.67
GO Classification
Functions
electron carrier activity / heme binding / metal ion binding
Processes
oxidation-reduction process
Components
periplasmic space
General Function
Metal ion binding
Specific Function
HMWC (high-molecular-weight cytochrome c), ORF2, ORF3, ORF4, ORF5 and ORF6 in the HMC operon form a transmembrane protein complex that allows electron flow from the periplasmic hydrogenase to the cytoplasmic enzymes that catalyze reduction of sulfates.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Periplasm
Gene sequence
>lcl|BSEQ0020565|High-molecular-weight cytochrome c (hmcA)
ATGTCTGAGGATGTGTATCACCCATTCTTCCAAAGGACTGCCACTATGAGGAACGGAAGG
ACACTGCTGCGATGGGCGGGAGTGTTGGCTGCCACCGCCATCATCGGCGTCGGCGGTTTC
TGGTCACAGGGGACGACCAAGGCCCTCCCCGAAGGGCCGGGCGAAAAACGCGCCGACCTG
ATCGAGATCGGGGCCATGGAACGCTTCGGGAAGCTTGATCTTCCCAAGGTGGCGTTCCGC
CACGACCAGCACACCACCGCCGTGACGGGCATGGGCAAGGACTGCGCCGCCTGTCACAAG
AGCAAGGACGGCAAGATGTCGCTGAAGTTCATGCGGCTTGACGACAACAGCGCCGCTGAA
CTCAAGGAAATCTACCACGCCAACTGTATCGGCTGTCATACCGACCTCGCCAAGGCCGGT
AAGAAGACCGGCCCGCAGGACGGCGAATGCCGCTCGTGCCACAACCCGAAGCCCTCTGCC
GCCTCGTCGTGGAAGGAGATAGGCTTCGACAAGTCGCTGCACTACCGTCACGTGGCGTCC
AAGGCCATCAAGCCCGTGGGCGACCCGCAGAAGAACTGCGGCGCTTGCCACCACGTCTAT
GACGAAGCTTCCAAGAAGCTCGTATGGGGTAAGAACAAGGAAGACTCGTGCCGCGCCTGT
CACGGCGAGAAGCCCGTGGACAAGCGTCCCGCGCTCGACACCGCCGCCCACACCGCGTGC
ATCAGCTGCCACATGGACGTCGCCAAGACCAAGGCCGAGACCGGCCCGGTCAACTGCGCC
GGCTGCCACGCCCCCGAGGCGCAGGCCAAGTTCAAGGTGGTACGCGAAGTGCCCCGCCTC
GACCGCGGTCAGCCCGACGCCGCCCTCATCCTGCCCGTACCCGGCAAGGATGCCCCGCGC
GAGATGAAGGGCACCATGAAGCCGGTCGCCTTCGACCACAAGGCCCACGAAGCCAAGGCC
AACGACTGCCGCACCTGCCACCATGTGCGCATCGACACCTGCACCGCCTGCCATACCGTG
AACGGTACCGCAGACAGCAAGTTCGTCCAGCTTGAAAAGGCCATGCACCAGCCCGACTCC
ATGCGCAGCTGCGTGGGTTGTCACAACACCCGCGTCCAGCAGCCCACCTGTGCCGGTTGC
CACGGCTTCATCAAGCCCACGAAGAGCGATGCCCAGTGCGGCGTGTGCCACGTGGCCGCC
CCCGGCTTCGACGCCAAGCAGGTCGAAGCGGGCGCATTGCTGAACCTCAAGGCAGAGCAG
CGTTCGCAGGTTGCCGCCTCCATGCTGTCGGCCCGTCCGCAGCCCAAGGGCACCTTCGAC
CTCAATGACATCCCCGAAAAGGTCGTCATCGGCTCCATCGCCAAGGAATACCAGCCCAGC
GAGTTCCCGCACCGCAAGATCGTGAAGACGCTCATCGCCGGTATCGGTGAAGACAAGCTG
GCCGCCACCTTCCACATCGAGAAGGGCACGCTGTGCCAGGGCTGCCACCACAACAGCCCC
GCCAGCCTCACCCCGCCCAAATGCGCGAGCTGCCACGGCAAGCCCTTCGACGCCGACAGG
GGCGACCGTCCCGGTCTCAAGGCCGCCTACCACCAGCAGTGCATGGGCTGCCACGACCGG
ATGAAGATCGAAAAGCCGGCGAACACCGCCTGCGTCGATTGCCACAAGGAACGCGCGAAA
TAG
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP24092
UniProtKB Entry NameHMWC_DESVH
GenBank Protein ID145081
GenBank Gene IDM63807
General References
  1. Pollock WB, Loutfi M, Bruschi M, Rapp-Giles BJ, Wall JD, Voordouw G: Cloning, sequencing, and expression of the gene encoding the high-molecular-weight cytochrome c from Desulfovibrio vulgaris Hildenborough. J Bacteriol. 1991 Jan;173(1):220-8. [PubMed:1846136]
  2. Heidelberg JF, Seshadri R, Haveman SA, Hemme CL, Paulsen IT, Kolonay JF, Eisen JA, Ward N, Methe B, Brinkac LM, Daugherty SC, Deboy RT, Dodson RJ, Durkin AS, Madupu R, Nelson WC, Sullivan SA, Fouts D, Haft DH, Selengut J, Peterson JD, Davidsen TM, Zafar N, Zhou L, Radune D, Dimitrov G, Hance M, Tran K, Khouri H, Gill J, Utterback TR, Feldblyum TV, Wall JD, Voordouw G, Fraser CM: The genome sequence of the anaerobic, sulfate-reducing bacterium Desulfovibrio vulgaris Hildenborough. Nat Biotechnol. 2004 May;22(5):554-9. Epub 2004 Apr 11. [PubMed:15077118]
  3. Tan JA, Cowan JA: Coordination and redox properties of a novel triheme cytochrome from Desulfovibrio vulgaris (Hildenborough). Biochemistry. 1990 May 22;29(20):4886-92. [PubMed:2163671]
  4. Bruschi M, Bertrand P, More C, Leroy G, Bonicel J, Haladjian J, Chottard G, Pollock WB, Voordouw G: Biochemical and spectroscopic characterization of the high molecular weight cytochrome c from Desulfovibrio vulgaris Hildenborough expressed in Desulfovibrio desulfuricans G200. Biochemistry. 1992 Mar 31;31(12):3281-8. [PubMed:1313289]
  5. Rossi M, Pollock WB, Reij MW, Keon RG, Fu R, Voordouw G: The hmc operon of Desulfovibrio vulgaris subsp. vulgaris Hildenborough encodes a potential transmembrane redox protein complex. J Bacteriol. 1993 Aug;175(15):4699-711. [PubMed:8335628]
  6. Verhagen MF, Pierik AJ, Wolbert RB, Mallee LF, Voorhorst WG, Hagen WR: Axial coordination and reduction potentials of the sixteen hemes in high-molecular-mass cytochrome c from Desulfovibrio vulgaris (Hildenborough). Eur J Biochem. 1994 Oct 1;225(1):311-9. [PubMed:7925451]
  7. Matias PM, Coelho AV, Valente FM, Placido D, LeGall J, Xavier AV, Pereira IA, Carrondo MA: Sulfate respiration in Desulfovibrio vulgaris Hildenborough. Structure of the 16-heme cytochrome c HmcA AT 2.5-A resolution and a view of its role in transmembrane electron transfer. J Biol Chem. 2002 Dec 6;277(49):47907-16. Epub 2002 Sep 27. [PubMed:12356749]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB03317Heme CexperimentalunknownDetails