Platelet-activating factor receptor

Details

Name
Platelet-activating factor receptor
Synonyms
  • PAF-R
  • PAFR
Gene Name
PTAFR
Organism
Humans
Amino acid sequence
>lcl|BSEQ0019761|Platelet-activating factor receptor
MEPHDSSHMDSEFRYTLFPIVYSIIFVLGVIANGYVLWVFARLYPCKKFNEIKIFMVNLT
MADMLFLITLPLWIVYYQNQGNWILPKFLCNVAGCLFFINTYCSVAFLGVITYNRFQAVT
RPIKTAQANTRKRGISLSLVIWVAIVGAASYFLILDSTNTVPDSAGSGNVTRCFEHYEKG
SVPVLIIHIFIVFSFFLVFLIILFCNLVIIRTLLMQPVQQQRNAEVKRRALWMVCTVLAV
FIICFVPHHVVQLPWTLAELGFQDSKFHQAINDAHQVTLCLLSTNCVLDPVIYCFLTKKF
RKHLTEKFYSMRSSRKCSRATTDTVTEVVVPFNQIPGNSLKN
Number of residues
342
Molecular Weight
39203.075
Theoretical pI
Not Available
GO Classification
Functions
G-protein coupled purinergic nucleotide receptor activity / G-protein coupled receptor activity / lipopolysaccharide binding / lipopolysaccharide receptor activity / phospholipid binding / platelet activating factor receptor activity
Processes
chemotaxis / cytokine production / cytokine-mediated signaling pathway / G-protein coupled purinergic nucleotide receptor signaling pathway / G-protein coupled receptor signaling pathway / immune response / inflammatory response / inositol trisphosphate biosynthetic process / interferon-gamma-mediated signaling pathway / phosphatidylinositol-mediated signaling
Components
integral component of membrane / integral component of plasma membrane / intracellular membrane-bounded organelle / membrane / nucleoplasm / plasma membrane
General Function
Platelet activating factor receptor activity
Specific Function
Receptor for platelet activating factor, a chemotactic phospholipid mediator that possesses potent inflammatory, smooth-muscle contractile and hypotensive activity. Seems to mediate its action via a G protein that activates a phosphatidylinositol-calcium second messenger system.
Pfam Domain Function
Transmembrane Regions
17-38 55-74 92-113 134-155 185-205 234-254 277-296
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0019762|Platelet-activating factor receptor (PTAFR)
ATGGAGCCACATGACTCCTCCCACATGGACTCTGAGTTCCGATACACTCTCTTCCCGATT
GTTTACAGCATCATCTTTGTGCTCGGGGTCATTGCTAATGGCTACGTGCTGTGGGTCTTT
GCCCGCCTGTACCCTTGCAAGAAATTCAATGAGATAAAGATCTTCATGGTGAACCTCACC
ATGGCGGACATGCTCTTCTTGATCACCCTGCCACTTTGGATTGTCTACTACCAAAACCAG
GGCAACTGGATACTCCCCAAATTCCTGTGCAACGTGGCTGGCTGCCTTTTCTTCATCAAC
ACCTACTGCTCTGTGGCCTTCCTGGGCGTCATCACTTATAACCGCTTCCAGGCAGTAACT
CGGCCCATCAAGACTGCTCAGGCCAACACCCGCAAGCGTGGCATCTCTTTGTCCTTGGTC
ATCTGGGTGGCCATTGTGGGAGCTGCATCCTACTTCCTCATCCTGGACTCCACCAACACA
GTGCCCGACAGTGCTGGCTCAGGCAACGTCACTCGCTGCTTTGAGCATTACGAGAAGGGC
AGCGTGCCAGTCCTCATCATCCACATCTTCATCGTGTTCAGCTTCTTCCTGGTCTTCCTC
ATCATCCTCTTCTGCAACCTGGTCATCATCCGTACCTTGCTCATGCAGCCGGTGCAGCAG
CAGCGCAACGCTGAAGTCAAGCGCCGGGCGCTGTGGATGGTGTGCACGGTCTTGGCGGTG
TTCATCATCTGCTTCGTGCCCCACCACGTGGTGCAGCTGCCCTGGACCCTTGCTGAGCTG
GGCTTCCAGGACAGCAAATTCCACCAGGCCATTAATGATGCACATCAGGTCACCCTCTGC
CTCCTTAGCACCAACTGTGTCTTAGACCCTGTTATCTACTGTTTCCTCACCAAGAAGTTC
CGCAAGCACCTCACCGAAAAGTTCTACAGCATGCGCAGTAGCCGGAAATGCTCCCGGGCC
ACCACGGATACGGTCACTGAAGTGGTTGTGCCATTCAACCAGATCCCTGGCAATTCCCTC
AAAAATTAG
Chromosome Location
1
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP25105
UniProtKB Entry NamePTAFR_HUMAN
HGNC IDHGNC:9582
General References
  1. Ye RD, Prossnitz ER, Zou AH, Cochrane CG: Characterization of a human cDNA that encodes a functional receptor for platelet activating factor. Biochem Biophys Res Commun. 1991 Oct 15;180(1):105-11. [PubMed:1656963]
  2. Nakamura M, Honda Z, Izumi T, Sakanaka C, Mutoh H, Minami M, Bito H, Seyama Y, Matsumoto T, Noma M, et al.: Molecular cloning and expression of platelet-activating factor receptor from human leukocytes. J Biol Chem. 1991 Oct 25;266(30):20400-5. [PubMed:1657923]
  3. Kunz D, Gerard NP, Gerard C: The human leukocyte platelet-activating factor receptor. cDNA cloning, cell surface expression, and construction of a novel epitope-bearing analog. J Biol Chem. 1992 May 5;267(13):9101-6. [PubMed:1374385]
  4. Seyfried CE, Schweickart VL, Godiska R, Gray PW: The human platelet-activating factor receptor gene (PTAFR) contains no introns and maps to chromosome 1. Genomics. 1992 Jul;13(3):832-4. [PubMed:1322356]
  5. Sugimoto T, Tsuchimochi H, McGregor CG, Mutoh H, Shimizu T, Kurachi Y: Molecular cloning and characterization of the platelet-activating factor receptor gene expressed in the human heart. Biochem Biophys Res Commun. 1992 Dec 15;189(2):617-24. [PubMed:1281995]
  6. Chase PB, Halonen M, Regan JW: Cloning of a human platelet-activating factor receptor gene: evidence for an intron in the 5'-untranslated region. Am J Respir Cell Mol Biol. 1993 Mar;8(3):240-4. [PubMed:8383507]
  7. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039]
  8. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  9. McLaughlin NJ, Banerjee A, Kelher MR, Gamboni-Robertson F, Hamiel C, Sheppard FR, Moore EE, Silliman CC: Platelet-activating factor-induced clathrin-mediated endocytosis requires beta-arrestin-1 recruitment and activation of the p38 MAPK signalosome at the plasma membrane for actin bundle formation. J Immunol. 2006 Jun 1;176(11):7039-50. [PubMed:16709866]
  10. Cargill M, Altshuler D, Ireland J, Sklar P, Ardlie K, Patil N, Shaw N, Lane CR, Lim EP, Kalyanaraman N, Nemesh J, Ziaugra L, Friedland L, Rolfe A, Warrington J, Lipshutz R, Daley GQ, Lander ES: Characterization of single-nucleotide polymorphisms in coding regions of human genes. Nat Genet. 1999 Jul;22(3):231-8. [PubMed:10391209]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB09166EtizolamexperimentalunknownantagonistDetails
DB11614RupatadineapprovedyesantagonistDetails
DB02261Platelet Activating FactorexperimentalunknownDetails