Ephrin type-A receptor 8

Details

Name
Ephrin type-A receptor 8
Synonyms
  • 2.7.10.1
  • EEK
  • EK3
  • EPH- and ELK-related kinase
  • EPH-like kinase 3
  • HEK3
  • KIAA1459
  • Tyrosine-protein kinase receptor EEK
Gene Name
EPHA8
Organism
Humans
Amino acid sequence
>lcl|BSEQ0051758|Ephrin type-A receptor 8
MAPARGRLPPALWVVTAAAAAATCVSAARGEVNLLDTSTIHGDWGWLTYPAHGWDSINEV
DESFQPIHTYQVCNVMSPNQNNWLRTSWVPRDGARRVYAEIKFTLRDCNSMPGVLGTCKE
TFNLYYLESDRDLGASTQESQFLKIDTIAADESFTGADLGVRRLKLNTEVRSVGPLSKRG
FYLAFQDIGACLAILSLRIYYKKCPAMVRNLAAFSEAVTGADSSSLVEVRGQCVRHSEER
DTPKMYCSAEGEWLVPIGKCVCSAGYEERRDACVACELGFYKSAPGDQLCARCPPHSHSA
APAAQACHCDLSYYRAALDPPSSACTRPPSAPVNLISSVNGTSVTLEWAPPLDPGGRSDI
TYNAVCRRCPWALSRCEACGSGTRFVPQQTSLVQASLLVANLLAHMNYSFWIEAVNGVSD
LSPEPRRAAVVNITTNQAAPSQVVVIRQERAGQTSVSLLWQEPEQPNGIILEYEIKYYEK
DKEMQSYSTLKAVTTRATVSGLKPGTRYVFQVRARTSAGCGRFSQAMEVETGKPRPRYDT
RTIVWICLTLITGLVVLLLLLICKKRHCGYSKAFQDSDEEKMHYQNGQAPPPVFLPLHHP
PGKLPEPQFYAEPHTYEEPGRAGRSFTREIEASRIHIEKIIGSGDSGEVCYGRLRVPGQR
DVPVAIKALKAGYTERQRRDFLSEASIMGQFDHPNIIRLEGVVTRGRLAMIVTEYMENGS
LDTFLRTHDGQFTIMQLVGMLRGVGAGMRYLSDLGYVHRDLAARNVLVDSNLVCKVSDFG
LSRVLEDDPDAAYTTTGGKIPIRWTAPEAIAFRTFSSASDVWSFGVVMWEVLAYGERPYW
NMTNRDVISSVEEGYRLPAPMGCPHALHQLMLDCWHKDRAQRPRFSQIVSVLDALIRSPE
SLRATATVSRCPPPAFVRSCFDLRGGSGGGGGLTVGDWLDSIRMGRYRDHFAAGGYSSLG
MVLRMNAQDVRALGITLMGHQKKILGSIQTMRAQLTSTQGPRRHL
Number of residues
1005
Molecular Weight
111001.57
Theoretical pI
Not Available
GO Classification
Functions
ATP binding / GPI-linked ephrin receptor activity
Processes
axon guidance / cell adhesion / cellular response to follicle-stimulating hormone stimulus / ephrin receptor signaling pathway / neuron projection development / neuron remodeling / positive regulation of MAPK cascade / positive regulation of phosphatidylinositol 3-kinase activity / protein autophosphorylation / regulation of cell adhesion / regulation of cell adhesion mediated by integrin / substrate-dependent cell migration
Components
early endosome membrane / integral component of plasma membrane / neuron projection / plasma membrane
General Function
Receptor tyrosine kinase which binds promiscuously GPI-anchored ephrin-A family ligands residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. The GPI-anchored ephrin-A EFNA2, EFNA3, and EFNA5 are able to activate EPHA8 through phosphorylation. With EFNA5 may regulate integrin-mediated cell adhesion and migration on fibronectin substrate but also neurite outgrowth. During development of the nervous system plays also a role in axon guidance. Downstream effectors of the EPHA8 signaling pathway include FYN which promotes cell adhesion upon activation by EPHA8 and the MAP kinases in the stimulation of neurite outgrowth (By similarity).
Specific Function
Atp binding
Pfam Domain Function
Transmembrane Regions
543-563
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0051759|Ephrin type-A receptor 8 (EPHA8)
ATGGCCCCCGCCCGGGGCCGCCTGCCCCCTGCGCTCTGGGTCGTCACGGCCGCGGCGGCG
GCGGCCACCTGCGTGTCCGCGGCGCGCGGCGAAGTGAATTTGCTGGACACGTCGACCATC
CACGGGGACTGGGGCTGGCTCACGTATCCGGCTCATGGGTGGGACTCCATCAACGAGGTG
GACGAGTCCTTCCAGCCCATCCACACGTACCAGGTTTGCAACGTCATGAGCCCCAACCAG
AACAACTGGCTGCGCACGAGCTGGGTCCCCCGAGACGGCGCCCGGCGCGTCTATGCTGAG
ATCAAGTTTACCCTGCGCGACTGCAACAGCATGCCTGGTGTGCTGGGCACCTGCAAGGAG
ACCTTCAACCTCTACTACCTGGAGTCGGACCGCGACCTGGGGGCCAGCACACAAGAAAGC
CAGTTCCTCAAAATCGACACCATTGCGGCCGACGAGAGCTTCACAGGTGCCGACCTTGGT
GTGCGGCGTCTCAAGCTCAACACGGAGGTGCGCAGTGTGGGTCCCCTCAGCAAGCGCGGC
TTCTACCTGGCCTTCCAGGACATAGGTGCCTGCCTGGCCATCCTCTCTCTCCGCATCTAC
TATAAGAAGTGCCCTGCCATGGTGCGCAATCTGGCTGCCTTCTCGGAGGCAGTGACGGGG
GCCGACTCGTCCTCACTGGTGGAGGTGAGGGGCCAGTGCGTGCGGCACTCAGAGGAGCGG
GACACACCCAAGATGTACTGCAGCGCGGAGGGCGAGTGGCTCGTGCCCATCGGCAAATGC
GTGTGCAGTGCCGGCTACGAGGAGCGGCGGGATGCCTGTGTGGCCTGTGAGCTGGGCTTC
TACAAGTCAGCCCCTGGGGACCAGCTGTGTGCCCGCTGCCCTCCCCACAGCCACTCCGCA
GCTCCAGCCGCCCAAGCCTGCCACTGTGACCTCAGCTACTACCGTGCAGCCCTGGACCCG
CCGTCCTCAGCCTGCACCCGGCCACCCTCGGCACCAGTGAACCTGATCTCCAGTGTGAAT
GGGACATCAGTGACTCTGGAGTGGGCCCCTCCCCTGGACCCAGGTGGCCGCAGTGACATC
ACCTACAATGCCGTGTGCCGCCGCTGCCCCTGGGCACTGAGCCGCTGCGAGGCATGTGGG
AGCGGCACCCGCTTTGTGCCCCAGCAGACAAGCCTGGTGCAGGCCAGCCTGCTGGTGGCC
AACCTGCTGGCCCACATGAACTACTCCTTCTGGATCGAGGCCGTCAATGGCGTGTCCGAC
CTGAGCCCCGAGCCCCGCCGGGCCGCTGTGGTCAACATCACCACGAACCAGGCAGCCCCG
TCCCAGGTGGTGGTGATCCGTCAAGAGCGGGCGGGGCAGACCAGCGTCTCGCTGCTGTGG
CAGGAGCCCGAGCAGCCGAACGGCATCATCCTGGAGTATGAGATCAAGTACTACGAGAAG
GACAAGGAGATGCAGAGCTACTCCACCCTCAAGGCCGTCACCACCAGAGCCACCGTCTCC
GGCCTCAAGCCGGGCACCCGCTACGTGTTCCAGGTCCGAGCCCGCACCTCAGCAGGCTGT
GGCCGCTTCAGCCAGGCCATGGAGGTGGAGACCGGGAAACCCCGGCCCCGCTATGACACC
AGGACCATTGTCTGGATCTGCCTGACGCTCATCACGGGCCTGGTGGTGCTTCTGCTCCTG
CTCATCTGCAAGAAGAGGCACTGTGGCTACAGCAAGGCCTTCCAGGACTCGGACGAGGAG
AAGATGCACTATCAGAATGGACAGGCACCCCCACCTGTCTTCCTGCCTCTGCATCACCCC
CCGGGAAAGCTCCCAGAGCCCCAGTTCTATGCGGAACCCCACACCTACGAGGAGCCAGGC
CGGGCGGGCCGCAGTTTCACTCGGGAGATCGAGGCCTCTAGGATCCACATCGAGAAAATC
ATCGGCTCTGGAGACTCCGGGGAAGTCTGCTACGGGAGGCTGCGGGTGCCAGGGCAGCGG
GATGTGCCCGTGGCCATCAAGGCCCTCAAAGCCGGCTACACGGAGAGACAGAGGCGGGAC
TTCCTGAGCGAGGCGTCCATCATGGGGCAATTCGACCATCCCAACATCATCCGCCTCGAG
GGTGTCGTCACCCGTGGCCGCCTGGCAATGATTGTGACTGAGTACATGGAGAACGGCTCT
CTGGACACCTTCCTGAGGACCCACGACGGGCAGTTCACCATCATGCAGCTGGTGGGCATG
CTGAGAGGAGTGGGTGCCGGCATGCGCTACCTCTCAGACCTGGGCTATGTCCACCGAGAC
CTGGCCGCCCGCAACGTCCTGGTTGACAGCAACCTGGTCTGCAAGGTGTCTGACTTCGGG
CTCTCACGGGTGCTGGAGGACGACCCGGATGCTGCCTACACCACCACGGGCGGGAAGATC
CCCATCCGCTGGACGGCCCCAGAGGCCATCGCCTTCCGCACCTTCTCCTCGGCCAGCGAC
GTGTGGAGCTTCGGCGTGGTCATGTGGGAGGTGCTGGCCTATGGGGAGCGGCCCTACTGG
AACATGACCAACCGGGATGTCATCAGCTCTGTGGAGGAGGGGTACCGCCTGCCCGCACCC
ATGGGCTGCCCCCACGCCCTGCACCAGCTCATGCTCGACTGTTGGCACAAGGACCGGGCG
CAGCGGCCTCGCTTCTCCCAGATTGTCAGTGTCCTCGATGCGCTCATCCGCAGCCCTGAG
AGTCTCAGGGCCACCGCCACAGTCAGCAGGTGCCCACCCCCTGCCTTCGTCCGGAGCTGC
TTTGACCTCCGAGGGGGCAGCGGTGGCGGTGGGGGCCTCACCGTGGGGGACTGGCTGGAC
TCCATCCGCATGGGCCGGTACCGAGACCACTTCGCTGCGGGCGGATACTCCTCTCTGGGC
ATGGTGCTACGCATGAACGCCCAGGACGTGCGCGCCCTGGGCATCACCCTCATGGGCCAC
CAGAAGAAGATCCTGGGCAGCATTCAGACCATGCGGGCCCAGCTGACCAGCACCCAGGGG
CCCCGCCGGCACCTCTGA
Chromosome Location
1
Locus
1p36.12
External Identifiers
ResourceLink
UniProtKB IDP29322
UniProtKB Entry NameEPHA8_HUMAN
HGNC IDHGNC:3391
General References
  1. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [PubMed:16710414]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  3. Nagase T, Kikuno R, Ishikawa K, Hirosawa M, Ohara O: Prediction of the coding sequences of unidentified human genes. XVII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro. DNA Res. 2000 Apr 28;7(2):143-50. [PubMed:10819331]
  4. Chan J, Watt VM: eek and erk, new members of the eph subclass of receptor protein-tyrosine kinases. Oncogene. 1991 Jun;6(6):1057-61. [PubMed:1648701]
  5. Authors unspecified: Unified nomenclature for Eph family receptors and their ligands, the ephrins. Eph Nomenclature Committee. Cell. 1997 Aug 8;90(3):403-4. [PubMed:9267020]
  6. Choi S, Park S: Phosphorylation at Tyr-838 in the kinase domain of EphA8 modulates Fyn binding to the Tyr-615 site by enhancing tyrosine kinase activity. Oncogene. 1999 Sep 23;18(39):5413-22. [PubMed:10498895]
  7. Gu C, Park S: The EphA8 receptor regulates integrin activity through p110gamma phosphatidylinositol-3 kinase in a tyrosine kinase activity-independent manner. Mol Cell Biol. 2001 Jul;21(14):4579-97. [PubMed:11416136]
  8. Shin J, Gu C, Park E, Park S: Identification of phosphotyrosine binding domain-containing proteins as novel downstream targets of the EphA8 signaling function. Mol Cell Biol. 2007 Dec;27(23):8113-26. Epub 2007 Sep 17. [PubMed:17875921]
  9. Yoo S, Shin J, Park S: EphA8-ephrinA5 signaling and clathrin-mediated endocytosis is regulated by Tiam-1, a Rac-specific guanine nucleotide exchange factor. Mol Cells. 2010 Jun;29(6):603-9. doi: 10.1007/s10059-010-0075-2. Epub 2010 May 22. [PubMed:20496116]
  10. Greenman C, Stephens P, Smith R, Dalgliesh GL, Hunter C, Bignell G, Davies H, Teague J, Butler A, Stevens C, Edkins S, O'Meara S, Vastrik I, Schmidt EE, Avis T, Barthorpe S, Bhamra G, Buck G, Choudhury B, Clements J, Cole J, Dicks E, Forbes S, Gray K, Halliday K, Harrison R, Hills K, Hinton J, Jenkinson A, Jones D, Menzies A, Mironenko T, Perry J, Raine K, Richardson D, Shepherd R, Small A, Tofts C, Varian J, Webb T, West S, Widaa S, Yates A, Cahill DP, Louis DN, Goldstraw P, Nicholson AG, Brasseur F, Looijenga L, Weber BL, Chiew YE, DeFazio A, Greaves MF, Green AR, Campbell P, Birney E, Easton DF, Chenevix-Trench G, Tan MH, Khoo SK, Teh BT, Yuen ST, Leung SY, Wooster R, Futreal PA, Stratton MR: Patterns of somatic mutation in human cancer genomes. Nature. 2007 Mar 8;446(7132):153-8. [PubMed:17344846]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB12010Fostamatinibapproved, investigationalunknowninhibitorDetails