D-lactate dehydrogenase

Details

Name
D-lactate dehydrogenase
Synonyms
  • 1.1.1.28
  • D-LDH
  • D-specific 2-hydroxyacid dehydrogenase
Gene Name
Not Available
Organism
Lactobacillus helveticus
Amino acid sequence
>lcl|BSEQ0011402|D-lactate dehydrogenase
MTKVFAYAIRKDEEPFLNEWKEAHKDIDVDYTDKLLTPETAKLAKGADGVVVYQQLDYTA
DTLQALADAGVTKMSLRNVGVDNIDMDKAKELGFQITNVPVYSPNAIAEHAAIQAARVLR
QDKRMDEKMAKRDLRWAPTIGREVRDQVVGVVGTGHIGQVFMRIMEGFGAKVIAYDIFKN
PELEKKGYYVDSLDDLYKQADVISLHVPDVPANVHMINDKSIAEMKDGVVIVNCSRGRLV
DTDAVIRGLDSGKIFGFVMDTYEDEVGVFNKDWEGKEFPDKRLADLIDRPNVLVTPHTAF
YTTHAVRNMVVKAFNNNLKLINGEKPDSPVALNKNKF
Number of residues
337
Molecular Weight
37778.94
Theoretical pI
5.7
GO Classification
Functions
D-lactate dehydrogenase activity / NAD binding
General Function
Nad binding
Specific Function
Not Available
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Not Available
Gene sequence
>lcl|BSEQ0003852|1014 bp
ATGACAAAGGTTTTTGCTTACGCTATTCGAAAAGACGAAGAACCATTCTTGAATGAATGG
AAGGAAGCTCACAAGGATATCGATGTTGATTACACTGATAAGCTTTTGACTCCTGAAACT
GCTAAGCTAGCTAAGGGTGCTGACGGTGTTGTTGTTTACCAACAATTAGACTACACTGCA
GATACTCTTCAAGCTTTAGCAGACGCTGGCGTAACTAAGATGTCATTACGTAACGTTGGT
GTTGACAACATTGATATGGACAAGGCTAAGGAATTAGGTTTCCAAATTACCAATGTTCCT
GTTTACTCACCAAACGCTATTGCTGAACATGCTGCTATTCAAGCTGCACGTGTATTACGT
CAAGACAAGCGCATGGACGAAAAGATGGCTAAACGTGACTTACGTTGGGCACCAACTATC
GGCCGTGAAGTTCGTGACCAAGTTGTCGGTGTTGTTGGTACCGGTCACATTGGTCAAGTA
TTTATGCGTATTATGGAAGGTTTCGGCGCAAAGGTTATTGCTTACGATATCTTCAAGAAC
CCAGAACTTGAAAAGAAGGGTTACTACGTTGACTCACTTGACGACTTGTACAAGCAAGCT
GATGTAATTTCACTTCACGTACCAGATGTTCCAGCTAACGTTCACATGATCAACGACAAG
TCAATCGCTGAAATGAAAGACGGCGTTGTAATTGTAAACTGCTCACGTGGTCGACTTGTT
GACACTGACGCTGTAATCCGTGGTTTGGACTCAGGCAAGATCTTCGGCTTCGTTATGGAT
ACTTACGAAGACGAAGTTGGTGTATTTAACAAGGATTGGGAAGGTAAAGAATTCCCAGAC
AAGCGTTTGGCAGACTTAATTGATCGTCCAAACGTATTGGTAACTCCACACACCGCCTTC
TACACTACTCACGCTGTACGTAACATGGTTGTTAAGGCATTCAACAACAACTTGAAGTTA
ATCAACGGCGAAAAGCCAGATTCTCCAGTTGCTTTGAACAAGAACAAGTTTTAA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP30901
UniProtKB Entry NameLDHD_LACHE
GenBank Protein ID43997
GenBank Gene IDX66723
General References
  1. Kochhar S, Hottinger H, Chuard N, Taylor PG, Atkinson T, Scawen MD, Nicholls DJ: Cloning and overexpression of Lactobacillus helveticus D-lactate dehydrogenase gene in Escherichia coli. Eur J Biochem. 1992 Sep 15;208(3):799-805. [PubMed:1396685]
  2. Bhowmik T, Steele JL: Cloning, characterization and insertional inactivation of the Lactobacillus helveticus D(-) lactate dehydrogenase gene. Appl Microbiol Biotechnol. 1994 Jun;41(4):432-9. [PubMed:7765104]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB03940Oxamic AcidexperimentalunknownDetails