Protoporphyrinogen oxidase

Details

Name
Protoporphyrinogen oxidase
Synonyms
  • 1.3.3.4
  • hemG
  • PPO
Gene Name
hemY
Organism
Bacillus subtilis (strain 168)
Amino acid sequence
>lcl|BSEQ0012654|Protoporphyrinogen oxidase
MSDGKKHVVIIGGGITGLAAAFYMEKEIKEKNLPLELTLVEASPRVGGKIQTVKKDGYII
ERGPDSFLERKKSAPQLVKDLGLEHLLVNNATGQSYVLVNRTLHPMPKGAVMGIPTKIAP
FVSTGLFSLSGKARAAMDFILPASKTKDDQSLGEFFRRRVGDEVVENLIEPLLSGIYAGD
IDKLSLMSTFPQFYQTEQKHRSLILGMKKTRPQGSGQQLTAKKQGQFQTLSTGLQTLVEE
IEKQLKLTKVYKGTKVTKLSHSGSCYSLELDNGVTLDADSVIVTAPHKAAAGMLSELPAI
SHLKNMHSTSVANVALGFPEGSVQMEHEGTGFVISRNSDFAITACTWTNKKWPHAAPEGK
TLLRAYVGKAGDESIVDLSDNDIINIVLEDLKKVMNINGEPEMTCVTRWHESMPQYHVGH
KQRIKELREALASAYPGVYMTGASFEGVGIPDCIDQGKAAVSDALTYLFS
Number of residues
470
Molecular Weight
51202.545
Theoretical pI
8.3
GO Classification
Functions
oxygen-dependent protoporphyrinogen oxidase activity
Processes
protoporphyrinogen IX biosynthetic process
Components
cytoplasm
General Function
Oxygen-dependent protoporphyrinogen oxidase activity
Specific Function
Catalyzes the 6-electron oxidation of protoporphyrinogen-IX to form protoporphyrin-IX. Also oxidizes the pathway intermediate coproporphyrinogen-III.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Cytoplasm
Gene sequence
>lcl|BSEQ0012655|Protoporphyrinogen oxidase (hemY)
ATGAGTGACGGCAAAAAACATGTAGTCATCATCGGCGGCGGCATTACCGGTTTAGCCGCC
GCCTTCTATATGGAAAAAGAAATCAAAGAAAAGAATCTGCCGCTTGAGCTGACACTTGTT
GAGGCAAGTCCGAGAGTCGGCGGGAAAATCCAGACTGTCAAGAAAGACGGCTATATCATC
GAAAGAGGGCCAGACTCATTTCTGGAACGAAAGAAAAGCGCCCCGCAGCTTGTTAAAGAC
TTAGGTCTTGAGCATTTGCTTGTCAACAATGCGACCGGGCAATCCTATGTGCTTGTAAAC
CGCACCCTGCATCCAATGCCGAAGGGCGCTGTAATGGGGATACCGACAAAAATTGCGCCG
TTTGTTTCTACGGGTCTGTTTTCCTTGTCCGGGAAGGCGAGAGCTGCTATGGATTTCATC
CTGCCTGCAAGCAAAACAAAGGATGATCAGTCATTGGGAGAATTCTTCCGCAGACGTGTC
GGAGATGAAGTGGTCGAGAACTTAATCGAGCCGCTACTATCAGGGATCTACGCAGGCGAC
ATTGACAAGCTCAGCCTGATGTCGACATTTCCGCAATTTTATCAGACGGAACAAAAGCAT
AGAAGCCTGATTCTCGGCATGAAAAAAACAAGGCCTCAAGGCTCAGGCCAGCAGCTGACG
GCAAAAAAACAAGGGCAGTTCCAAACTCTGTCAACCGGTTTGCAGACCCTTGTAGAAGAG
ATCGAAAAGCAGTTAAAGCTGACGAAGGTGTATAAAGGCACAAAAGTGACCAAACTTAGC
CATAGCGGCTCTTGCTATTCGCTCGAACTGGATAACGGCGTCACACTTGATGCTGATTCA
GTAATTGTGACTGCTCCGCATAAAGCGGCTGCGGGAATGCTTTCTGAGCTTCCTGCCATT
TCTCATTTGAAAAATATGCACTCCACATCCGTGGCAAACGTCGCTTTAGGTTTCCCTGAA
GGCTCCGTCCAAATGGAGCATGAGGGCACGGGTTTTGTCATTTCAAGAAACAGTGACTTT
GCGATCACAGCCTGTACGTGGACGAATAAAAAATGGCCGCACGCAGCGCCGGAAGGCAAA
ACGCTGCTTCGGGCATATGTCGGAAAAGCCGGAGACGAATCCATTGTCGATCTATCAGAT
AATGACATTATCAACATTGTGTTAGAAGACTTAAAGAAAGTCATGAACATAAACGGCGAG
CCGGAAATGACATGTGTAACCCGATGGCATGAAAGCATGCCGCAGTACCATGTCGGCCAT
AAGCAGCGTATCAAGGAGCTGCGTGAAGCACTTGCATCTGCGTATCCGGGTGTTTATATG
ACAGGCGCTTCTTTCGAAGGTGTCGGCATTCCCGACTGCATTGATCAAGGAAAAGCTGCC
GTGTCTGACGCGCTTACCTATTTATTCAGCTAA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP32397
UniProtKB Entry NamePPOX_BACSU
GenBank Protein ID143042
GenBank Gene IDM97208
General References
  1. Hansson M, Hederstedt L: Cloning and characterization of the Bacillus subtilis hemEHY gene cluster, which encodes protoheme IX biosynthetic enzymes. J Bacteriol. 1992 Dec;174(24):8081-93. [PubMed:1459957]
  2. Noback MA, Holsappel S, Kiewiet R, Terpstra P, Wambutt R, Wedler H, Venema G, Bron S: The 172 kb prkA-addAB region from 83 degrees to 97 degrees of the Bacillus subtilis chromosome contains several dysfunctional genes, the glyB marker, many genes encoding transporter proteins, and the ubiquitous hit gene. Microbiology. 1998 Apr;144 ( Pt 4):859-75. [PubMed:9579061]
  3. Kunst F, Ogasawara N, Moszer I, Albertini AM, Alloni G, Azevedo V, Bertero MG, Bessieres P, Bolotin A, Borchert S, Borriss R, Boursier L, Brans A, Braun M, Brignell SC, Bron S, Brouillet S, Bruschi CV, Caldwell B, Capuano V, Carter NM, Choi SK, Cordani JJ, Connerton IF, Cummings NJ, Daniel RA, Denziot F, Devine KM, Dusterhoft A, Ehrlich SD, Emmerson PT, Entian KD, Errington J, Fabret C, Ferrari E, Foulger D, Fritz C, Fujita M, Fujita Y, Fuma S, Galizzi A, Galleron N, Ghim SY, Glaser P, Goffeau A, Golightly EJ, Grandi G, Guiseppi G, Guy BJ, Haga K, Haiech J, Harwood CR, Henaut A, Hilbert H, Holsappel S, Hosono S, Hullo MF, Itaya M, Jones L, Joris B, Karamata D, Kasahara Y, Klaerr-Blanchard M, Klein C, Kobayashi Y, Koetter P, Koningstein G, Krogh S, Kumano M, Kurita K, Lapidus A, Lardinois S, Lauber J, Lazarevic V, Lee SM, Levine A, Liu H, Masuda S, Mauel C, Medigue C, Medina N, Mellado RP, Mizuno M, Moestl D, Nakai S, Noback M, Noone D, O'Reilly M, Ogawa K, Ogiwara A, Oudega B, Park SH, Parro V, Pohl TM, Portelle D, Porwollik S, Prescott AM, Presecan E, Pujic P, Purnelle B, Rapoport G, Rey M, Reynolds S, Rieger M, Rivolta C, Rocha E, Roche B, Rose M, Sadaie Y, Sato T, Scanlan E, Schleich S, Schroeter R, Scoffone F, Sekiguchi J, Sekowska A, Seror SJ, Serror P, Shin BS, Soldo B, Sorokin A, Tacconi E, Takagi T, Takahashi H, Takemaru K, Takeuchi M, Tamakoshi A, Tanaka T, Terpstra P, Togoni A, Tosato V, Uchiyama S, Vandebol M, Vannier F, Vassarotti A, Viari A, Wambutt R, Wedler H, Weitzenegger T, Winters P, Wipat A, Yamamoto H, Yamane K, Yasumoto K, Yata K, Yoshida K, Yoshikawa HF, Zumstein E, Yoshikawa H, Danchin A: The complete genome sequence of the gram-positive bacterium Bacillus subtilis. Nature. 1997 Nov 20;390(6657):249-56. [PubMed:9384377]
  4. Dailey TA, Meissner P, Dailey HA: Expression of a cloned protoporphyrinogen oxidase. J Biol Chem. 1994 Jan 14;269(2):813-5. [PubMed:8288631]
  5. Sun L, Wen X, Tan Y, Li H, Yang X, Zhao Y, Wang B, Cao Q, Niu C, Xi Z: Site-directed mutagenesis and computational study of the Y366 active site in Bacillus subtilis protoporphyrinogen oxidase. Amino Acids. 2009 Sep;37(3):523-30. doi: 10.1007/s00726-009-0256-5. Epub 2009 Mar 6. [PubMed:19266155]
  6. Qin X, Sun L, Wen X, Yang X, Tan Y, Jin H, Cao Q, Zhou W, Xi Z, Shen Y: Structural insight into unique properties of protoporphyrinogen oxidase from Bacillus subtilis. J Struct Biol. 2010 Apr;170(1):76-82. doi: 10.1016/j.jsb.2009.11.012. Epub 2009 Nov 26. [PubMed:19944166]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB07338AcifluorfenexperimentalunknownDetails