Cadherin-5

Details

Name
Cadherin-5
Synonyms
  • 7B4 antigen
  • Vascular endothelial cadherin
  • VE-cadherin
Gene Name
CDH5
Organism
Humans
Amino acid sequence
>lcl|BSEQ0037231|Cadherin-5
MQRLMMLLATSGACLGLLAVAAVAAAGANPAQRDTHSLLPTHRRQKRDWIWNQMHIDEEK
NTSLPHHVGKIKSSVSRKNAKYLLKGEYVGKVFRVDAETGDVFAIERLDRENISEYHLTA
VIVDKDTGENLETPSSFTIKVHDVNDNWPVFTHRLFNASVPESSAVGTSVISVTAVDADD
PTVGDHASVMYQILKGKEYFAIDNSGRIITITKSLDREKQARYEIVVEARDAQGLRGDSG
TATVLVTLQDINDNFPFFTQTKYTFVVPEDTRVGTSVGSLFVEDPDEPQNRMTKYSILRG
DYQDAFTIETNPAHNEGIIKPMKPLDYEYIQQYSFIVEATDPTIDLRYMSPPAGNRAQVI
INITDVDEPPIFQQPFYHFQLKENQKKPLIGTVLAMDPDAARHSIGYSIRRTSDKGQFFR
VTKKGDIYNEKELDREVYPWYNLTVEAKELDSTGTPTGKESIVQVHIEVLDENDNAPEFA
KPYQPKVCENAVHGQLVLQISAIDKDITPRNVKFKFILNTENNFTLTDNHDNTANITVKY
GQFDREHTKVHFLPVVISDNGMPSRTGTSTLTVAVCKCNEQGEFTFCEDMAAQVGVSIQA
VVAILLCILTITVITLLIFLRRRLRKQARAHGKSVPEIHEQLVTYDEEGGGEMDTTSYDV
SVLNSVRRGGAKPPRPALDARPSLYAQVQKPPRHAPGAHGGPGEMAAMIEVKKDEADHDG
DGPPYDTLHIYGYEGSESIAESLSSLGTDSSDSDVDYDFLNDWGPRFKMLAELYGSDPRE
ELLY
Number of residues
784
Molecular Weight
87527.715
Theoretical pI
5.07
GO Classification
Functions
beta-catenin binding / calcium ion binding / ion channel binding / receptor binding
Processes
adherens junction organization / blood vessel maturation / cell junction assembly / cell-cell junction assembly / cell-cell junction organization / homophilic cell adhesion via plasma membrane adhesion molecules / negative regulation of cell proliferation / positive regulation of establishment of endothelial barrier / regulation of establishment of cell polarity / transforming growth factor beta receptor signaling pathway / vascular endothelial growth factor receptor signaling pathway
Components
adherens junction / bicellular tight junction / cell junction / cell surface / cell-cell junction / external side of plasma membrane / integral component of membrane / membrane / plasma membrane
General Function
Receptor binding
Specific Function
Cadherins are calcium-dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types. This cadherin may play a important role in endothelial cell biology through control of the cohesion and organization of the intercellular junctions. It associates with alpha-catenin forming a link to the cytoskeleton. Acts in concert with KRIT1 to establish and maintain correct endothelial cell polarity and vascular lumen. These effects are mediated by recruitment and activation of the Par polarity complex and RAP1B. Required for activation of PRKCZ and for the localization of phosphorylated PRKCZ, PARD3, TIAM1 and RAP1B to the cell junction.
Pfam Domain Function
Transmembrane Regions
600-620
Cellular Location
Cell junction
Gene sequence
>lcl|BSEQ0012383|Cadherin-5 (CDH5)
ATGCAGAGGCTCATGATGCTCCTCGCCACATCGGGCGCCTGCCTGGGCCTGCTGGCAGTG
GCAGCAGTGGCAGCAGCAGGTGCTAACCCTGCCCAACGGGACACCCACAGCCTGCTGCCC
ACCCACCGGCGCCAAAAGAGAGATTGGATTTGGAACCAGATGCACATTGATGAAGAGAAA
AACACCTCACTTCCCCATCATGTAGGCAAGATCAAGTCAAGCGTGAGTCGCAAGAATGCC
AAGTACCTGCTCAAAGGAGAATATGTGGGCAAGGTCTTCCGGGTCGATGCAGAGACAGGA
GACGTGTTCGCCATTGAGAGGCTGGACCGGGAGAATATCTCAGAGTACCACCTCACTGCT
GTCATTGTGGACAAGGACACTGGCGAAAACCTGGAGACTCCTTCCAGCTTCACCATCAAA
GTTCATGACGTGAACGACAACTGGCCTGTGTTCACGCATCGGTTGTTCAATGCGTCCGTG
CCTGAGTCGTCGGCTGTGGGGACCTCAGTCATCTCTGTGACAGCAGTGGATGCAGACGAC
CCCACTGTGGGAGACCACGCCTCTGTCATGTACCAAATCCTGAAGGGGAAAGAGTATTTT
GCCATCGATAATTCTGGACGTATTATCACAATAACGAAAAGCTTGGACCGAGAGAAGCAG
GCCAGGTATGAGATCGTGGTGGAAGCGCGAGATGCCCAGGGCCTCCGGGGGGACTCGGGC
ACGGCCACCGTGCTGGTCACTCTGCAAGACATCAATGACAACTTCCCCTTCTTCACCCAG
ACCAAGTACACATTTGTCGTGCCTGAAGACACCCGTGTGGGCACCTCTGTGGGCTCTCTG
TTTGTTGAGGACCCAGATGAGCCCCAGAACCGGATGACCAAGTACAGCATCTTGCGGGGC
GACTACCAGGACGCTTTCACCATTGAGACAAACCCCGCCCACAACGAGGGCATCATCAAG
CCCATGAAGCCTCTGGATTATGAATACATCCAGCAATACAGCTTCATCGTCGAGGCCACA
GACCCCACCATCGACCTCCGATACATGAGCCCTCCCGCGGGAAACAGAGCCCAGGTCATT
ATCAACATCACAGATGTGGACGAGCCCCCCATTTTCCAGCAGCCTTTCTACCACTTCCAG
CTGAAGGAAAACCAGAAGAAGCCTCTGATTGGCACAGTGCTGGCCATGGACCCTGATGCG
GCTAGGCATAGCATTGGATACTCCATCCGCAGGACCAGTGACAAGGGCCAGTTCTTCCGA
GTCACAAAAAAGGGGGACATTTACAATGAGAAAGAACTGGACAGAGAAGTCTACCCCTGG
TATAACCTGACTGTGGAGGCCAAAGAACTGGATTCCACTGGAACCCCCACAGGAAAAGAA
TCCATTGTGCAAGTCCACATTGAAGTTTTGGATGAGAATGACAATGCCCCGGAGTTTGCC
AAGCCCTACCAGCCCAAAGTGTGTGAGAACGCTGTCCATGGCCAGCTGGTCCTGCAGATC
TCCGCAATAGACAAGGACATAACACCACGAAACGTGAAGTTCAAATTCATCTTGAATACT
GAGAACAACTTTACCCTCACGGATAATCACGATAACACGGCCAACATCACAGTCAAGTAT
GGGCAGTTTGACCGGGAGCATACCAAGGTCCACTTCCTACCCGTGGTCATCTCAGACAAT
GGGATGCCAAGTCGCACGGGCACCAGCACGCTGACCGTGGCCGTGTGCAAGTGCAACGAG
CAGGGCGAGTTCACCTTCTGCGAGGATATGGCCGCCCAGGTGGGCGTGAGCATCCAGGCA
GTGGTAGCCATCTTACTCTGCATCCTCACCATCACAGTGATCACCCTGCTCATCTTCCTG
CGGCGGCGGCTCCGGAAGCAGGCCCGCGCGCACGGCAAGAGCGTGCCGGAGATCCACGAG
CAGCTGGTCACCTACGACGAGGAGGGCGGCGGCGAGATGGACACCACCAGCTACGATGTG
TCGGTGCTCAACTCGGTGCGCCGCGGCGGGGCCAAGCCCCCGCGGCCCGCGCTGGACGCC
CGGCCTTCCCTCTATGCGCAGGTGCAGAAGCCACCGAGGCACGCGCCTGGGGCACACGGA
GGGCCCGGGGAGATGGCAGCCATGATCGAGGTGAAGAAGGACGAGGCGGACCACGACGGC
GACGGCCCCCCCTACGACACGCTGCACATCTACGGCTACGAGGGCTCCGAGTCCATAGCC
GAGTCCCTCAGCTCCCTGGGCACCGACTCATCCGACTCTGACGTGGATTACGACTTCCTT
AACGACTGGGGACCCAGGTTTAAGATGCTGGCTGAGCTGTACGGCTCGGACCCCCGGGAG
GAGCTGCTGTATTAG
Chromosome Location
16
Locus
16q22.1
External Identifiers
ResourceLink
UniProtKB IDP33151
UniProtKB Entry NameCADH5_HUMAN
GenBank Gene IDX79981
GenAtlas IDCDH5
HGNC IDHGNC:1764
General References
  1. Breviario F, Caveda L, Corada M, Martin-Padura I, Navarro P, Golay J, Introna M, Gulino D, Lampugnani MG, Dejana E: Functional properties of human vascular endothelial cadherin (7B4/cadherin-5), an endothelium-specific cadherin. Arterioscler Thromb Vasc Biol. 1995 Aug;15(8):1229-39. [PubMed:7627717]
  2. Ali J, Liao F, Martens E, Muller WA: Vascular endothelial cadherin (VE-cadherin): cloning and role in endothelial cell-cell adhesion. Microcirculation. 1997 Jun;4(2):267-77. [PubMed:9219219]
  3. Shimoyama Y, Tsujimoto G, Kitajima M, Natori M: Identification of three human type-II classic cadherins and frequent heterophilic interactions between different subclasses of type-II classic cadherins. Biochem J. 2000 Jul 1;349(Pt 1):159-67. [PubMed:10861224]
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  5. Suzuki S, Sano K, Tanihara H: Diversity of the cadherin family: evidence for eight new cadherins in nervous tissue. Cell Regul. 1991 Apr;2(4):261-70. [PubMed:2059658]
  6. Lampugnani MG, Resnati M, Raiteri M, Pigott R, Pisacane A, Houen G, Ruco LP, Dejana E: A novel endothelial-specific membrane protein is a marker of cell-cell contacts. J Cell Biol. 1992 Sep;118(6):1511-22. [PubMed:1522121]
  7. Liu T, Qian WJ, Gritsenko MA, Camp DG 2nd, Monroe ME, Moore RJ, Smith RD: Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry. J Proteome Res. 2005 Nov-Dec;4(6):2070-80. [PubMed:16335952]
  8. Jia W, Lu Z, Fu Y, Wang HP, Wang LH, Chi H, Yuan ZF, Zheng ZB, Song LN, Han HH, Liang YM, Wang JL, Cai Y, Zhang YK, Deng YL, Ying WT, He SM, Qian XH: A strategy for precise and large scale identification of core fucosylated glycoproteins. Mol Cell Proteomics. 2009 May;8(5):913-23. doi: 10.1074/mcp.M800504-MCP200. Epub 2009 Jan 12. [PubMed:19139490]
  9. Graziani A, Poteser M, Heupel WM, Schleifer H, Krenn M, Drenckhahn D, Romanin C, Baumgartner W, Groschner K: Cell-cell contact formation governs Ca2+ signaling by TRPC4 in the vascular endothelium: evidence for a regulatory TRPC4-beta-catenin interaction. J Biol Chem. 2010 Feb 5;285(6):4213-23. doi: 10.1074/jbc.M109.060301. Epub 2009 Dec 8. [PubMed:19996314]
  10. Lampugnani MG, Orsenigo F, Rudini N, Maddaluno L, Boulday G, Chapon F, Dejana E: CCM1 regulates vascular-lumen organization by inducing endothelial polarity. J Cell Sci. 2010 Apr 1;123(Pt 7):1073-80. doi: 10.1242/jcs.059329. [PubMed:20332120]
  11. Brasch J, Harrison OJ, Ahlsen G, Carnally SM, Henderson RM, Honig B, Shapiro L: Structure and binding mechanism of vascular endothelial cadherin: a divergent classical cadherin. J Mol Biol. 2011 Apr 22;408(1):57-73. doi: 10.1016/j.jmb.2011.01.031. Epub 2011 Jan 24. [PubMed:21269602]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB05685FX06investigationalunknownDetails
DB00480LenalidomideapprovedunknownantagonistDetails