Isocitrate dehydrogenase [NADP]

Details

Name
Isocitrate dehydrogenase [NADP]
Synonyms
  • 1.1.1.42
  • citC
  • IDH
  • IDP
  • NADP(+)-specific ICDH
  • Oxalosuccinate decarboxylase
Gene Name
icd
Organism
Bacillus subtilis (strain 168)
Amino acid sequence
>lcl|BSEQ0011078|Isocitrate dehydrogenase [NADP]
MAQGEKITVSNGVLNVPNNPIIPFIEGDGTGPDIWNAASKVLEAAVEKAYKGEKKITWKE
VYAGEKAYNKTGEWLPAETLDVIREYFIAIKGPLTTPVGGGIRSLNVALRQELDLFVCLR
PVRYFTGVPSPVKRPEDTDMVIFRENTEDIYAGIEYAKGSEEVQKLISFLQNELNVNKIR
FPETSGIGIKPVSEEGTSRLVRAAIDYAIEHGRKSVTLVHKGNIMKFTEGAFKNWGYELA
EKEYGDKVFTWAQYDRIAEEQGKDAANKAQSEAEAAGKIIIKDSIADIFLQQILTRPNEF
DVVATMNLNGDYISDALAAQVGGIGIAPGANINYETGHAIFEATHGTAPKYAGLDKVNPS
SVILSGVLLLEHLGWNEAADLVIKSMEKTIASKVVTYDFARLMDGATEVKCSEFGEELIK
NMD
Number of residues
423
Molecular Weight
46417.39
Theoretical pI
4.74
GO Classification
Functions
isocitrate dehydrogenase (NADP+) activity / magnesium ion binding / NAD binding
Processes
glyoxylate cycle / tricarboxylic acid cycle
General Function
Nad binding
Specific Function
Not Available
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Not Available
Gene sequence
>lcl|BSEQ0011079|Isocitrate dehydrogenase [NADP] (icd)
GTGGCACAAGGTGAAAAAATTACAGTCTCTAACGGAGTATTAAACGTACCAAACAACCCG
ATTATCCCATTTATCGAAGGAGACGGAACCGGTCCTGATATTTGGAACGCGGCTTCGAAG
GTTTTGGAAGCAGCAGTAGAAAAAGCATACAAAGGCGAAAAGAAAATTACATGGAAAGAA
GTTTACGCCGGAGAAAAGGCTTATAATAAAACAGGTGAGTGGCTCCCTGCTGAAACATTA
GATGTGATCCGCGAATATTTCATCGCGATTAAAGGCCCGTTAACGACACCTGTCGGCGGC
GGTATCCGTTCTTTGAACGTAGCGCTCAGACAAGAGCTTGACCTATTCGTCTGCTTAAGA
CCTGTAAGATACTTTACTGGAGTGCCGTCACCGGTAAAACGCCCTGAAGATACTGATATG
GTCATCTTCCGTGAAAATACAGAAGATATTTACGCAGGCATCGAGTATGCAAAAGGCTCT
GAAGAAGTGCAAAAGCTTATCAGCTTCCTTCAAAATGAGTTAAACGTCAATAAAATCCGT
TTCCCTGAGACATCAGGTATCGGCATTAAGCCTGTTTCAGAAGAAGGAACAAGCCGCTTG
GTCAGAGCTGCCATTGATTATGCGATCGAGCATGGCCGCAAATCTGTAACACTTGTTCAC
AAAGGAAACATCATGAAGTTCACAGAAGGCGCCTTCAAAAACTGGGGCTATGAACTTGCT
GAAAAAGAATACGGAGATAAAGTCTTCACATGGGCTCAATATGACCGCATTGCTGAAGAA
CAAGGAAAAGACGCTGCCAACAAAGCGCAAAGCGAAGCGGAAGCAGCAGGAAAAATCATT
ATCAAAGACAGCATTGCTGACATTTTCCTTCAGCAGATCTTAACGCGTCCAAACGAGTTT
GATGTCGTTGCGACAATGAACTTGAACGGAGATTACATTTCTGATGCTCTTGCTGCGCAA
GTCGGCGGAATCGGCATTGCTCCTGGAGCGAACATCAACTACGAAACAGGACATGCGATT
TTCGAGGCGACGCACGGAACGGCTCCTAAATATGCAGGCCTTGATAAAGTAAACCCATCT
TCAGTTATTCTTTCAGGCGTTCTGCTTCTTGAGCATTTAGGATGGAACGAAGCGGCTGAT
TTGGTTATCAAATCTATGGAAAAAACAATCGCTTCTAAAGTCGTAACTTACGATTTTGCC
AGATTAATGGACGGGGCGACTGAAGTGAAATGTTCAGAGTTCGGAGAAGAACTGATCAAA
AACATGGACTAA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP39126
UniProtKB Entry NameIDH_BACSU
GenBank Protein ID487434
GenBank Gene IDU05257
General References
  1. Jin S, Sonenshein AL: Identification of two distinct Bacillus subtilis citrate synthase genes. J Bacteriol. 1994 Aug;176(15):4669-79. [PubMed:8045898]
  2. Lapidus A, Galleron N, Sorokin A, Ehrlich SD: Sequencing and functional annotation of the Bacillus subtilis genes in the 200 kb rrnB-dnaB region. Microbiology. 1997 Nov;143 ( Pt 11):3431-41. [PubMed:9387221]
  3. Kunst F, Ogasawara N, Moszer I, Albertini AM, Alloni G, Azevedo V, Bertero MG, Bessieres P, Bolotin A, Borchert S, Borriss R, Boursier L, Brans A, Braun M, Brignell SC, Bron S, Brouillet S, Bruschi CV, Caldwell B, Capuano V, Carter NM, Choi SK, Cordani JJ, Connerton IF, Cummings NJ, Daniel RA, Denziot F, Devine KM, Dusterhoft A, Ehrlich SD, Emmerson PT, Entian KD, Errington J, Fabret C, Ferrari E, Foulger D, Fritz C, Fujita M, Fujita Y, Fuma S, Galizzi A, Galleron N, Ghim SY, Glaser P, Goffeau A, Golightly EJ, Grandi G, Guiseppi G, Guy BJ, Haga K, Haiech J, Harwood CR, Henaut A, Hilbert H, Holsappel S, Hosono S, Hullo MF, Itaya M, Jones L, Joris B, Karamata D, Kasahara Y, Klaerr-Blanchard M, Klein C, Kobayashi Y, Koetter P, Koningstein G, Krogh S, Kumano M, Kurita K, Lapidus A, Lardinois S, Lauber J, Lazarevic V, Lee SM, Levine A, Liu H, Masuda S, Mauel C, Medigue C, Medina N, Mellado RP, Mizuno M, Moestl D, Nakai S, Noback M, Noone D, O'Reilly M, Ogawa K, Ogiwara A, Oudega B, Park SH, Parro V, Pohl TM, Portelle D, Porwollik S, Prescott AM, Presecan E, Pujic P, Purnelle B, Rapoport G, Rey M, Reynolds S, Rieger M, Rivolta C, Rocha E, Roche B, Rose M, Sadaie Y, Sato T, Scanlan E, Schleich S, Schroeter R, Scoffone F, Sekiguchi J, Sekowska A, Seror SJ, Serror P, Shin BS, Soldo B, Sorokin A, Tacconi E, Takagi T, Takahashi H, Takemaru K, Takeuchi M, Tamakoshi A, Tanaka T, Terpstra P, Togoni A, Tosato V, Uchiyama S, Vandebol M, Vannier F, Vassarotti A, Viari A, Wambutt R, Wedler H, Weitzenegger T, Winters P, Wipat A, Yamamoto H, Yamane K, Yasumoto K, Yata K, Yoshida K, Yoshikawa HF, Zumstein E, Yoshikawa H, Danchin A: The complete genome sequence of the gram-positive bacterium Bacillus subtilis. Nature. 1997 Nov 20;390(6657):249-56. [PubMed:9384377]
  4. Singh SK, Miller SP, Dean A, Banaszak LJ, LaPorte DC: Bacillus subtilis isocitrate dehydrogenase. A substrate analogue for Escherichia coli isocitrate dehydrogenase kinase/phosphatase. J Biol Chem. 2002 Mar 1;277(9):7567-73. Epub 2002 Jan 7. [PubMed:11751849]
  5. Singh SK, Matsuno K, LaPorte DC, Banaszak LJ: Crystal structure of Bacillus subtilis isocitrate dehydrogenase at 1.55 A. Insights into the nature of substrate specificity exhibited by Escherichia coli isocitrate dehydrogenase kinase/phosphatase. J Biol Chem. 2001 Jul 13;276(28):26154-63. Epub 2001 Apr 4. [PubMed:11290745]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB02159(R)-Propylene glycolexperimentalunknownDetails
DB04272Citric acidapproved, nutraceutical, vet_approvedunknownDetails
DB04349(S)-propane-1,2-diolexperimentalunknownDetails
DB04530S,S-(2-Hydroxyethyl)ThiocysteineexperimentalunknownDetails