Bacilysin biosynthesis protein BacB

Details

Name
Bacilysin biosynthesis protein BacB
Synonyms
  • ywfC
Gene Name
bacB
Organism
Bacillus subtilis (strain 168)
Amino acid sequence
>lcl|BSEQ0020759|Bacilysin biosynthesis protein BacB
MKTKEDMQELYFPTPKLIEWENGVRQYSTVRGDTEVLMSYVPPHTNVEPHQHKEVQIGMV
VSGELMMTVGDVTRKMTALESAYIAPPHVPHGARNDTDQEVIAIDIKRLKADETYTSPED
YFLDIFKTRDLLPGMEVTFFVEDWVEIMLAKIPGNGGEMPFHKHRNEQIGICIGGGYDMT
VEGCTVEMKFGTAYFCEPREDHGAINRSEKESKSINIFFPPRYNRAKAKKMKADE
Number of residues
235
Molecular Weight
26839.49
Theoretical pI
5.21
GO Classification
Processes
antibiotic biosynthetic process
General Function
Not Available
Specific Function
Part of the bacABCDE operon responsible for the biosynthesis of bacilysin.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Not Available
Gene sequence
>lcl|BSEQ0020760|Bacilysin biosynthesis protein BacB (bacB)
ATGAAAACTAAAGAAGATATGCAGGAGCTTTATTTCCCGACACCGAAATTAATTGAATGG
GAAAACGGAGTGAGGCAGTATTCAACCGTACGAGGGGATACTGAAGTATTAATGTCTTAC
GTCCCGCCGCATACCAATGTTGAACCCCATCAGCATAAGGAGGTCCAAATCGGCATGGTC
GTTTCTGGCGAGCTGATGATGACTGTCGGAGATGTGACAAGAAAAATGACAGCCTTGGAA
TCTGCCTATATCGCGCCGCCGCATGTGCCTCACGGGGCAAGAAACGACACAGACCAAGAA
GTGATTGCTATTGATATCAAGCGGCTGAAAGCTGATGAAACATATACAAGTCCTGAGGAC
TACTTTTTGGATATTTTCAAAACAAGAGACCTGCTGCCGGGCATGGAAGTCACGTTCTTT
GTTGAGGATTGGGTAGAAATTATGCTTGCCAAAATCCCTGGAAATGGCGGAGAAATGCCT
TTCCATAAACATCGGAATGAACAAATAGGCATCTGCATCGGCGGCGGCTATGACATGACG
GTCGAAGGCTGCACAGTCGAGATGAAATTCGGCACAGCCTATTTCTGTGAGCCTCGCGAA
GATCATGGTGCCATCAACCGTTCAGAAAAAGAATCAAAATCGATTAATATCTTCTTCCCG
CCGCGCTATAACAGGGCAAAAGCAAAAAAAATGAAGGCGGATGAATGA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP39639
UniProtKB Entry NameBACB_BACSU
GenBank Protein ID413924
GenBank Gene IDX73124
General References
  1. Glaser P, Kunst F, Arnaud M, Coudart MP, Gonzales W, Hullo MF, Ionescu M, Lubochinsky B, Marcelino L, Moszer I, et al.: Bacillus subtilis genome project: cloning and sequencing of the 97 kb region from 325 degrees to 333 degrees. Mol Microbiol. 1993 Oct;10(2):371-84. [PubMed:7934828]
  2. Kunst F, Ogasawara N, Moszer I, Albertini AM, Alloni G, Azevedo V, Bertero MG, Bessieres P, Bolotin A, Borchert S, Borriss R, Boursier L, Brans A, Braun M, Brignell SC, Bron S, Brouillet S, Bruschi CV, Caldwell B, Capuano V, Carter NM, Choi SK, Cordani JJ, Connerton IF, Cummings NJ, Daniel RA, Denziot F, Devine KM, Dusterhoft A, Ehrlich SD, Emmerson PT, Entian KD, Errington J, Fabret C, Ferrari E, Foulger D, Fritz C, Fujita M, Fujita Y, Fuma S, Galizzi A, Galleron N, Ghim SY, Glaser P, Goffeau A, Golightly EJ, Grandi G, Guiseppi G, Guy BJ, Haga K, Haiech J, Harwood CR, Henaut A, Hilbert H, Holsappel S, Hosono S, Hullo MF, Itaya M, Jones L, Joris B, Karamata D, Kasahara Y, Klaerr-Blanchard M, Klein C, Kobayashi Y, Koetter P, Koningstein G, Krogh S, Kumano M, Kurita K, Lapidus A, Lardinois S, Lauber J, Lazarevic V, Lee SM, Levine A, Liu H, Masuda S, Mauel C, Medigue C, Medina N, Mellado RP, Mizuno M, Moestl D, Nakai S, Noback M, Noone D, O'Reilly M, Ogawa K, Ogiwara A, Oudega B, Park SH, Parro V, Pohl TM, Portelle D, Porwollik S, Prescott AM, Presecan E, Pujic P, Purnelle B, Rapoport G, Rey M, Reynolds S, Rieger M, Rivolta C, Rocha E, Roche B, Rose M, Sadaie Y, Sato T, Scanlan E, Schleich S, Schroeter R, Scoffone F, Sekiguchi J, Sekowska A, Seror SJ, Serror P, Shin BS, Soldo B, Sorokin A, Tacconi E, Takagi T, Takahashi H, Takemaru K, Takeuchi M, Tamakoshi A, Tanaka T, Terpstra P, Togoni A, Tosato V, Uchiyama S, Vandebol M, Vannier F, Vassarotti A, Viari A, Wambutt R, Wedler H, Weitzenegger T, Winters P, Wipat A, Yamamoto H, Yamane K, Yasumoto K, Yata K, Yoshida K, Yoshikawa HF, Zumstein E, Yoshikawa H, Danchin A: The complete genome sequence of the gram-positive bacterium Bacillus subtilis. Nature. 1997 Nov 20;390(6657):249-56. [PubMed:9384377]
  3. Inaoka T, Takahashi K, Ohnishi-Kameyama M, Yoshida M, Ochi K: Guanine nucleotides guanosine 5'-diphosphate 3'-diphosphate and GTP co-operatively regulate the production of an antibiotic bacilysin in Bacillus subtilis. J Biol Chem. 2003 Jan 24;278(4):2169-76. Epub 2002 Oct 7. [PubMed:12372825]
  4. Steinborn G, Hajirezaei MR, Hofemeister J: bac genes for recombinant bacilysin and anticapsin production in Bacillus host strains. Arch Microbiol. 2005 Feb;183(2):71-9. Epub 2004 Dec 18. [PubMed:15609023]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB03884Phenylpyruvic acidexperimentalunknownDetails