Transcription antiterminator LicT

Details

Name
Transcription antiterminator LicT
Synonyms
Not Available
Gene Name
licT
Organism
Bacillus subtilis (strain 168)
Amino acid sequence
>lcl|BSEQ0012324|Transcription antiterminator LicT
MKIAKVINNNVISVVNEQGKELVVMGRGLAFQKKSGDDVDEARIEKVFTLDNKDVSEKFK
TLLYDIPIECMEVSEEIISYAKLQLGKKLNDSIYVSLTDHINFAIQRNQKGLDIKNALLW
ETKRLYKDEFAIGKEALVMVKNKTGVSLPEDEAGFIALHIVNAELNEEMPNIINITKVMQ
EILSIVKYHFKIEFNEESLHYYRFVTHLKFFAQRLFNGTHMESQDDFLLDTVKEKYHRAY
ECTKKIQTYIEREYEHKLTSDELLYLTIHIERVVKQA
Number of residues
277
Molecular Weight
32317.03
Theoretical pI
6.25
GO Classification
Functions
RNA binding
Processes
positive regulation of transcription, DNA-templated / transcription, DNA-templated
General Function
Rna binding
Specific Function
Mediates positive regulation of the glucanase operon (licST) by functioning as an antiterminator factor of transcription. Prevents termination at terminator lic-t.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Cytoplasmic
Gene sequence
>lcl|BSEQ0012325|Transcription antiterminator LicT (licT)
ATGAAAATTGCGAAGGTGATCAACAATAATGTGATCAGCGTGGTCAATGAACAGGGGAAA
GAATTGGTCGTCATGGGCAGGGGGCTCGCGTTTCAGAAAAAGTCCGGCGATGATGTCGAT
GAAGCCCGCATTGAGAAAGTGTTCACGCTCGATAACAAGGATGTATCAGAAAAGTTCAAA
ACCCTTTTGTATGATATACCGATCGAGTGTATGGAAGTATCCGAAGAGATTATCAGCTAC
GCAAAATTACAGCTCGGCAAAAAGCTCAACGACAGCATCTATGTGTCGCTGACCGACCAT
ATTAACTTTGCCATCCAGCGCAACCAGAAAGGGCTTGATATCAAAAACGCCTTGCTGTGG
GAAACAAAACGGCTCTACAAAGACGAATTTGCGATCGGCAAAGAAGCGTTGGTTATGGTA
AAAAACAAGACTGGTGTGTCTCTGCCAGAGGATGAAGCAGGCTTTATTGCTCTGCATATT
GTAAATGCCGAGCTGAATGAAGAGATGCCCAATATTATCAACATTACAAAAGTCATGCAA
GAGATTTTGAGTATTGTAAAATACCATTTTAAGATTGAATTCAACGAAGAATCGCTTCAC
TATTATCGGTTCGTCACCCACTTAAAGTTTTTCGCGCAGCGTCTATTTAACGGCACTCAC
ATGGAAAGCCAGGACGATTTTTTGCTGGATACAGTGAAAGAAAAGTATCATCGCGCGTAT
GAATGCACGAAGAAAATCCAAACCTACATTGAGCGGGAGTATGAGCACAAGCTCACAAGT
GACGAGCTGCTGTATTTAACCATTCACATAGAAAGGGTAGTTAAACAAGCATAA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP39805
UniProtKB Entry NameLICT_BACSU
GenBank Gene IDZ28340
General References
  1. Schnetz K, Stulke J, Gertz S, Kruger S, Krieg M, Hecker M, Rak B: LicT, a Bacillus subtilis transcriptional antiterminator protein of the BglG family. J Bacteriol. 1996 Apr;178(7):1971-9. [PubMed:8606172]
  2. Yoshida K, Shindo K, Sano H, Seki S, Fujimura M, Yanai N, Miwa Y, Fujita Y: Sequencing of a 65 kb region of the Bacillus subtilis genome containing the lic and cel loci, and creation of a 177 kb contig covering the gnt-sacXY region. Microbiology. 1996 Nov;142 ( Pt 11):3113-23. [PubMed:8969509]
  3. Kunst F, Ogasawara N, Moszer I, Albertini AM, Alloni G, Azevedo V, Bertero MG, Bessieres P, Bolotin A, Borchert S, Borriss R, Boursier L, Brans A, Braun M, Brignell SC, Bron S, Brouillet S, Bruschi CV, Caldwell B, Capuano V, Carter NM, Choi SK, Cordani JJ, Connerton IF, Cummings NJ, Daniel RA, Denziot F, Devine KM, Dusterhoft A, Ehrlich SD, Emmerson PT, Entian KD, Errington J, Fabret C, Ferrari E, Foulger D, Fritz C, Fujita M, Fujita Y, Fuma S, Galizzi A, Galleron N, Ghim SY, Glaser P, Goffeau A, Golightly EJ, Grandi G, Guiseppi G, Guy BJ, Haga K, Haiech J, Harwood CR, Henaut A, Hilbert H, Holsappel S, Hosono S, Hullo MF, Itaya M, Jones L, Joris B, Karamata D, Kasahara Y, Klaerr-Blanchard M, Klein C, Kobayashi Y, Koetter P, Koningstein G, Krogh S, Kumano M, Kurita K, Lapidus A, Lardinois S, Lauber J, Lazarevic V, Lee SM, Levine A, Liu H, Masuda S, Mauel C, Medigue C, Medina N, Mellado RP, Mizuno M, Moestl D, Nakai S, Noback M, Noone D, O'Reilly M, Ogawa K, Ogiwara A, Oudega B, Park SH, Parro V, Pohl TM, Portelle D, Porwollik S, Prescott AM, Presecan E, Pujic P, Purnelle B, Rapoport G, Rey M, Reynolds S, Rieger M, Rivolta C, Rocha E, Roche B, Rose M, Sadaie Y, Sato T, Scanlan E, Schleich S, Schroeter R, Scoffone F, Sekiguchi J, Sekowska A, Seror SJ, Serror P, Shin BS, Soldo B, Sorokin A, Tacconi E, Takagi T, Takahashi H, Takemaru K, Takeuchi M, Tamakoshi A, Tanaka T, Terpstra P, Togoni A, Tosato V, Uchiyama S, Vandebol M, Vannier F, Vassarotti A, Viari A, Wambutt R, Wedler H, Weitzenegger T, Winters P, Wipat A, Yamamoto H, Yamane K, Yasumoto K, Yata K, Yoshida K, Yoshikawa HF, Zumstein E, Yoshikawa H, Danchin A: The complete genome sequence of the gram-positive bacterium Bacillus subtilis. Nature. 1997 Nov 20;390(6657):249-56. [PubMed:9384377]
  4. Barbe V, Cruveiller S, Kunst F, Lenoble P, Meurice G, Sekowska A, Vallenet D, Wang T, Moszer I, Medigue C, Danchin A: From a consortium sequence to a unified sequence: the Bacillus subtilis 168 reference genome a decade later. Microbiology. 2009 Jun;155(Pt 6):1758-75. doi: 10.1099/mic.0.027839-0. Epub 2009 Apr 21. [PubMed:19383706]
  5. Murphy N, McConnell DJ, Cantwell BA: The DNA sequence of the gene and genetic control sites for the excreted B. subtilis enzyme beta-glucanase. Nucleic Acids Res. 1984 Jul 11;12(13):5355-67. [PubMed:6087283]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB04530S,S-(2-Hydroxyethyl)ThiocysteineexperimentalunknownDetails