Penicillin-binding protein 3

Details

Name
Penicillin-binding protein 3
Synonyms
  • PBP 3
  • Penicillin-binding protein C
  • PSPB20
  • ycsM
  • yzsA
Gene Name
pbpC
Organism
Bacillus subtilis (strain 168)
Amino acid sequence
>lcl|BSEQ0010557|Penicillin-binding protein 3
MLKKCILLVFLCVGLIGLIGCSKTDSPEDRMEAFVKQWNDQQFDDMYQSLTKDVKKEISK
KDFVNRYKAIYEQAGVKNLKVTAGEVDKDDQDNKTMKHIPYKVSMNTNAGKVSFKNTAVL
KLEKTDDEESWNIDWDPSFIFKQLADDKTVQIMSIEPKRGQIYDKNGKGLAVNTDVPEIG
IVPGELGDKKEKVIKELAKKLDLTEDDIKKKLDQGWVKDDSFVPLKKVKPDQEKLVSEAT
SLQGVTRTNVSSRYYPYGEKTAHLTGYVRAITAEELKKKKEGTYSDTSNIGIAGLENVYE
DKLRGTTGWKIYVPQTGEVIAEKKAKDGEDLHLTIDIKTQMKLYDELKDDSGAAVALQPK
TGETLALVSAPSYDPNGFIFGWSDKEWKKLNKDKNNPFSAKFNKTYAPGSTIKPIAAAIG
IKNGTLKADEKKTIKGKEWQKDSSWGGYSVTRVSERLQQVDLENALITSDNIYFAQNALD
MGADTFTKGLKTFGFSEDVPYEFPIQKSSIANDKLDSDILLADTGYGQGQMQMSPLHLAT
AYTPFVDNGDLVKPTLIKKDSQTADVWHKQVVTKEGAADITKGLKGVVEDERGSAYQPVV
KGITVAGKTGTAELKTSKDDKDGTENGWFVGYDYENKDLLVAMMIQNVQDRGGSHYVVEK
AKKQFQSN
Number of residues
668
Molecular Weight
74405.915
Theoretical pI
6.56
GO Classification
Functions
penicillin binding
Processes
cell wall organization / peptidoglycan biosynthetic process / regulation of cell shape / response to antibiotic
Components
integral component of membrane / plasma membrane
General Function
Penicillin binding
Specific Function
Not Available
Pfam Domain Function
Transmembrane Regions
7-23
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0010558|Penicillin-binding protein 3 (pbpC)
ATGTTAAAAAAGTGTATTCTACTAGTATTTCTATGCGTCGGATTGATTGGGTTAATCGGA
TGCTCCAAAACAGATTCACCAGAGGATCGCATGGAAGCATTCGTGAAACAGTGGAACGAT
CAGCAATTCGATGACATGTATCAAAGCCTGACTAAAGATGTCAAAAAAGAAATCTCCAAA
AAAGATTTCGTCAACAGGTATAAAGCCATCTATGAGCAGGCCGGCGTAAAAAATTTGAAA
GTCACTGCGGGAGAAGTAGATAAGGACGATCAAGACAACAAGACGATGAAACATATCCCG
TATAAAGTCAGCATGAACACAAATGCCGGCAAAGTCAGCTTCAAGAATACTGCTGTGCTG
AAATTAGAAAAAACAGATGACGAGGAGTCATGGAATATAGATTGGGACCCATCGTTTATT
TTCAAGCAGCTGGCTGACGACAAAACCGTGCAAATTATGAGCATTGAACCGAAACGAGGC
CAAATTTACGATAAAAATGGAAAAGGCTTAGCCGTCAATACAGATGTTCCGGAAATTGGA
ATTGTTCCCGGAGAGCTTGGCGATAAAAAAGAGAAAGTCATAAAAGAACTCGCCAAAAAA
CTTGATTTGACTGAAGACGACATCAAGAAAAAGCTGGATCAAGGCTGGGTAAAAGACGAT
TCGTTTGTGCCGCTCAAAAAGGTCAAGCCTGACCAGGAGAAATTAGTTTCTGAAGCGACG
TCATTACAAGGCGTAACAAGAACGAATGTCAGCTCCCGCTACTATCCGTATGGCGAAAAG
ACAGCCCATTTGACAGGCTATGTCCGCGCCATTACAGCGGAAGAACTGAAGAAAAAGAAA
GAAGGAACGTACAGCGATACGTCTAACATCGGTATCGCCGGACTTGAAAATGTGTATGAA
GACAAGCTAAGAGGCACAACTGGCTGGAAAATCTACGTGCCGCAAACCGGGGAAGTCATC
GCTGAAAAGAAAGCAAAGGACGGCGAGGATCTTCACCTCACAATTGATATCAAAACGCAA
ATGAAGCTGTATGATGAACTGAAGGATGACAGCGGGGCGGCAGTCGCGCTGCAGCCGAAG
ACAGGCGAAACACTCGCCCTTGTCAGCGCGCCTTCCTACGATCCAAACGGATTTATTTTC
GGCTGGAGCGATAAGGAATGGAAAAAGCTAAACAAAGATAAAAACAATCCGTTTTCAGCG
AAATTCAATAAGACATACGCGCCAGGTTCTACCATTAAACCGATTGCGGCTGCTATTGGA
ATCAAAAACGGCACCCTTAAAGCCGATGAGAAGAAAACAATCAAAGGCAAGGAGTGGCAA
AAAGATTCAAGCTGGGGCGGCTATTCAGTGACACGTGTGTCTGAGAGACTTCAACAAGTC
GATTTGGAAAACGCCCTTATTACGTCAGACAATATTTATTTTGCCCAGAATGCGCTTGAT
ATGGGAGCGGACACCTTTACAAAAGGCTTGAAGACATTCGGTTTTTCAGAGGACGTTCCG
TACGAATTCCCGATCCAGAAATCGTCTATTGCAAATGACAAGCTTGATTCAGACATTTTG
CTTGCGGATACAGGCTACGGACAAGGGCAAATGCAAATGTCTCCGCTTCACTTGGCAACT
GCTTACACGCCATTTGTTGACAATGGAGACCTTGTCAAACCGACGCTGATCAAAAAAGAT
TCACAAACAGCTGATGTTTGGCACAAGCAAGTGGTCACGAAGGAAGGAGCGGCAGACATT
ACAAAAGGTCTGAAAGGCGTTGTGGAAGATGAGCGCGGATCAGCGTATCAGCCTGTCGTG
AAAGGAATCACAGTGGCTGGAAAAACAGGAACAGCCGAGCTGAAAACATCAAAAGATGAT
AAAGACGGCACGGAAAATGGCTGGTTTGTCGGCTACGATTACGAAAACAAAGACCTGCTT
GTCGCCATGATGATCCAAAATGTGCAGGACCGCGGCGGCAGCCACTATGTCGTTGAGAAA
GCGAAAAAGCAATTTCAATCGAATTAA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP42971
UniProtKB Entry NamePBPC_BACSU
GenBank Protein ID790944
GenBank Gene IDD38161
General References
  1. Akagawa E, Kurita K, Sugawara T, Nakamura K, Kasahara Y, Ogasawara N, Yamane K: Determination of a 17,484 bp nucleotide sequence around the 39 degrees region of the Bacillus subtilis chromosome and similarity analysis of the products of putative ORFs. Microbiology. 1995 Dec;141 ( Pt 12):3241-5. [PubMed:8574415]
  2. Yamane K, Kumano M, Kurita K: The 25 degrees-36 degrees region of the Bacillus subtilis chromosome: determination of the sequence of a 146 kb segment and identification of 113 genes. Microbiology. 1996 Nov;142 ( Pt 11):3047-56. [PubMed:8969502]
  3. Kunst F, Ogasawara N, Moszer I, Albertini AM, Alloni G, Azevedo V, Bertero MG, Bessieres P, Bolotin A, Borchert S, Borriss R, Boursier L, Brans A, Braun M, Brignell SC, Bron S, Brouillet S, Bruschi CV, Caldwell B, Capuano V, Carter NM, Choi SK, Cordani JJ, Connerton IF, Cummings NJ, Daniel RA, Denziot F, Devine KM, Dusterhoft A, Ehrlich SD, Emmerson PT, Entian KD, Errington J, Fabret C, Ferrari E, Foulger D, Fritz C, Fujita M, Fujita Y, Fuma S, Galizzi A, Galleron N, Ghim SY, Glaser P, Goffeau A, Golightly EJ, Grandi G, Guiseppi G, Guy BJ, Haga K, Haiech J, Harwood CR, Henaut A, Hilbert H, Holsappel S, Hosono S, Hullo MF, Itaya M, Jones L, Joris B, Karamata D, Kasahara Y, Klaerr-Blanchard M, Klein C, Kobayashi Y, Koetter P, Koningstein G, Krogh S, Kumano M, Kurita K, Lapidus A, Lardinois S, Lauber J, Lazarevic V, Lee SM, Levine A, Liu H, Masuda S, Mauel C, Medigue C, Medina N, Mellado RP, Mizuno M, Moestl D, Nakai S, Noback M, Noone D, O'Reilly M, Ogawa K, Ogiwara A, Oudega B, Park SH, Parro V, Pohl TM, Portelle D, Porwollik S, Prescott AM, Presecan E, Pujic P, Purnelle B, Rapoport G, Rey M, Reynolds S, Rieger M, Rivolta C, Rocha E, Roche B, Rose M, Sadaie Y, Sato T, Scanlan E, Schleich S, Schroeter R, Scoffone F, Sekiguchi J, Sekowska A, Seror SJ, Serror P, Shin BS, Soldo B, Sorokin A, Tacconi E, Takagi T, Takahashi H, Takemaru K, Takeuchi M, Tamakoshi A, Tanaka T, Terpstra P, Togoni A, Tosato V, Uchiyama S, Vandebol M, Vannier F, Vassarotti A, Viari A, Wambutt R, Wedler H, Weitzenegger T, Winters P, Wipat A, Yamamoto H, Yamane K, Yasumoto K, Yata K, Yoshida K, Yoshikawa HF, Zumstein E, Yoshikawa H, Danchin A: The complete genome sequence of the gram-positive bacterium Bacillus subtilis. Nature. 1997 Nov 20;390(6657):249-56. [PubMed:9384377]
  4. Smith H, de Jong A, Bron S, Venema G: Characterization of signal-sequence-coding regions selected from the Bacillus subtilis chromosome. Gene. 1988 Oct 30;70(2):351-61. [PubMed:3145906]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00355AztreonamapprovedyesinhibitorDetails
DB00493CefotaximeapprovedyesinhibitorDetails
DB01598ImipenemapprovedunknowninhibitorDetails
DB04570Latamoxefapproved, investigationalyesinhibitorDetails