Secretin receptor

Details

Name
Secretin receptor
Synonyms
  • SCT-R
Gene Name
SCTR
Organism
Humans
Amino acid sequence
>lcl|BSEQ0016064|Secretin receptor
MRPHLSPPLQQLLLPVLLACAAHSTGALPRLCDVLQVLWEEQDQCLQELSREQTGDLGTE
QPVPGCEGMWDNISCWPSSVPGRMVEVECPRFLRMLTSRNGSLFRNCTQDGWSETFPRPN
LACGVNVNDSSNEKRHSYLLKLKVMYTVGYSSSLVMLLVALGILCAFRRLHCTRNYIHMH
LFVSFILRALSNFIKDAVLFSSDDVTYCDAHRAGCKLVMVLFQYCIMANYSWLLVEGLYL
HTLLAISFFSERKYLQGFVAFGWGSPAIFVALWAIARHFLEDVGCWDINANASIWWIIRG
PVILSILINFILFINILRILMRKLRTQETRGNEVSHYKRLARSTLLLIPLFGIHYIVFAF
SPEDAMEIQLFFELALGSFQGLVVAVLYCFLNGEVQLEVQKKWQQWHLREFPLHPVASFS
NSTKASHLEQSQGTCRTSII
Number of residues
440
Molecular Weight
50206.135
Theoretical pI
7.77
GO Classification
Functions
secretin receptor activity
Processes
cell surface receptor signaling pathway / digestion / excretion / G-protein coupled receptor signaling pathway
Components
cytoplasmic microtubule / integral component of plasma membrane / plasma membrane
General Function
Secretin receptor activity
Specific Function
This is a receptor for secretin. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase.
Pfam Domain Function
Transmembrane Regions
144-167 175-194 217-240 255-276 295-317 344-362 370-392
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0016065|Secretin receptor (SCTR)
ATGCGTCCCCACCTGTCGCCGCCGCTGCAGCAGCTACTACTGCCGGTGCTGCTCGCCTGC
GCCGCGCACTCGACTGGAGCCCTTCCCCGACTATGTGACGTGCTACAAGTGCTGTGGGAA
GAGCAAGACCAGTGCCTGCAGGAACTCTCCAGAGAGCAGACAGGAGACCTGGGCACGGAG
CAGCCAGTGCCAGGTTGTGAGGGGATGTGGGACAACATAAGCTGCTGGCCCTCTTCTGTG
CCGGGCCGGATGGTGGAGGTGGAATGCCCGAGATTCCTCCGGATGCTCACCAGCAGAAAT
GGTTCCTTGTTCCGAAACTGCACACAGGATGGCTGGTCAGAAACCTTCCCCAGGCCTAAT
CTGGCCTGTGGCGTTAATGTGAACGACTCTTCCAACGAGAAGCGGCACTCCTACCTGCTG
AAGCTGAAAGTCATGTACACCGTGGGCTACAGCTCCTCCCTGGTCATGCTCCTGGTCGCC
CTTGGCATCCTCTGTGCTTTCCGGAGGCTCCACTGCACTCGCAACTACATCCACATGCAC
CTGTTCGTGTCCTTCATCCTTCGTGCCCTGTCCAACTTCATCAAGGACGCCGTGCTCTTC
TCCTCAGATGATGTCACCTACTGCGATGCCCACAGGGCGGGCTGCAAGCTGGTCATGGTG
CTGTTCCAGTACTGCATCATGGCCAACTACTCCTGGCTGCTGGTGGAAGGCCTCTACCTT
CACACACTCCTCGCCATCTCCTTCTTCTCTGAAAGAAAGTACCTCCAGGGATTTGTGGCA
TTCGGATGGGGTTCTCCAGCCATTTTTGTTGCTTTGTGGGCTATTGCCAGACACTTTCTG
GAAGATGTTGGGTGCTGGGACATCAATGCCAACGCATCCATCTGGTGGATCATTCGTGGT
CCTGTGATCCTCTCCATCCTGATTAATTTCATCCTTTTCATAAACATTCTAAGAATCCTG
ATGAGAAAACTTAGAACCCAAGAAACAAGAGGAAATGAAGTCAGCCATTATAAGCGCCTG
GCCAGGTCCACTCTCCTGCTGATCCCCCTCTTTGGCATCCACTACATCGTCTTCGCCTTC
TCCCCAGAGGACGCTATGGAGATCCAGCTGTTTTTTGAACTAGCCCTTGGCTCATTCCAG
GGACTGGTGGTGGCCGTCCTCTACTGCTTCCTCAATGGGGAGGTGCAGCTGGAGGTTCAG
AAGAAGTGGCAGCAATGGCACCTCCGTGAGTTCCCACTGCACCCCGTGGCCTCCTTCAGC
AACAGCACCAAGGCCAGCCACTTGGAGCAGAGCCAGGGCACCTGCAGGACCAGCATCATC
TGA
Chromosome Location
2
Locus
2q14.1
External Identifiers
ResourceLink
UniProtKB IDP47872
UniProtKB Entry NameSCTR_HUMAN
GenBank Protein ID662796
GenBank Gene IDU20178
GenAtlas IDSCTR
HGNC IDHGNC:10608
General References
  1. Jiang S, Ulrich C: Molecular cloning and functional expression of a human pancreatic secretin receptor. Biochem Biophys Res Commun. 1995 Feb 27;207(3):883-90. [PubMed:7864894]
  2. Chow BK: Molecular cloning and functional characterization of a human secretin receptor. Biochem Biophys Res Commun. 1995 Jul 6;212(1):204-11. [PubMed:7612008]
  3. Patel DR, Kong Y, Sreedharan SP: Molecular cloning and expression of a human secretin receptor. Mol Pharmacol. 1995 Mar;47(3):467-73. [PubMed:7700244]
  4. Hillier LW, Graves TA, Fulton RS, Fulton LA, Pepin KH, Minx P, Wagner-McPherson C, Layman D, Wylie K, Sekhon M, Becker MC, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Kremitzki C, Oddy L, Du H, Sun H, Bradshaw-Cordum H, Ali J, Carter J, Cordes M, Harris A, Isak A, van Brunt A, Nguyen C, Du F, Courtney L, Kalicki J, Ozersky P, Abbott S, Armstrong J, Belter EA, Caruso L, Cedroni M, Cotton M, Davidson T, Desai A, Elliott G, Erb T, Fronick C, Gaige T, Haakenson W, Haglund K, Holmes A, Harkins R, Kim K, Kruchowski SS, Strong CM, Grewal N, Goyea E, Hou S, Levy A, Martinka S, Mead K, McLellan MD, Meyer R, Randall-Maher J, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Shah N, Swearengen-Shahid S, Snider J, Strong JT, Thompson J, Yoakum M, Leonard S, Pearman C, Trani L, Radionenko M, Waligorski JE, Wang C, Rock SM, Tin-Wollam AM, Maupin R, Latreille P, Wendl MC, Yang SP, Pohl C, Wallis JW, Spieth J, Bieri TA, Berkowicz N, Nelson JO, Osborne J, Ding L, Meyer R, Sabo A, Shotland Y, Sinha P, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Jones TA, She X, Ciccarelli FD, Izaurralde E, Taylor J, Schmutz J, Myers RM, Cox DR, Huang X, McPherson JD, Mardis ER, Clifton SW, Warren WC, Chinwalla AT, Eddy SR, Marra MA, Ovcharenko I, Furey TS, Miller W, Eichler EE, Bork P, Suyama M, Torrents D, Waterston RH, Wilson RK: Generation and annotation of the DNA sequences of human chromosomes 2 and 4. Nature. 2005 Apr 7;434(7034):724-31. [PubMed:15815621]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB09532Secretin humanapprovedyesligandDetails