Endo-1,4-beta-xylanase Y

Details

Name
Endo-1,4-beta-xylanase Y
Synonyms
  • 1,4-beta-D-xylan xylanohydrolase Y
  • 3.2.1.8
  • Xylanase Y
  • XylY
Gene Name
xynY
Organism
Clostridium thermocellum
Amino acid sequence
>lcl|BSEQ0012104|Endo-1,4-beta-xylanase Y
MKNKRVLAKITALVVLLGVFFVLPSNISQLYADYEVVHDTFEVNFDGWCNLGVDTYLTAV
ENEGNNGTRGMMVINRSSASDGAYSEKGFYLDGGVEYKYSVFVKHNGTGTETFKLSVSYL
DSETEEENKEVIATKDVVAGEWTEISAKYKAPKTAVNITLSITTDSTVDFIFDDVTITRK
GMAEANTVYAANAVLKDMYANYFRVGSVLNSGTVNNSSIKALILREFNSITCENEMKPDA
TLVQSGSTNTNIRVSLNRAASILNFCAQNNIAVRGHTLVWHSQTPQWFFKDNFQDNGNWV
SQSVMDQRLESYIKNMFAEIQRQYPSLNLYAYDVVNEAVSDDANRTRYYGGAREPGYGNG
RSPWVQIYGDNKFIEKAFTYARKYAPANCKLYYNDYNEYWDHKRDCIASICANLYNKGLL
DGVGMQSHINADMNGFSGIQNYKAALQKYINIGCDVQITELDISTENGKFSLQQQADKYK
AVFQAAVDINRTSSKGKVTAVCVWGPNDANTWLGSQNAPLLFNANNQPKPAYNAVASIIP
QSEWGDGNNPAGGGGGGKPEEPDANGYYYHDTFEGSVGQWTARGPAEVLLSGRTAYKGSE
SLLVRNRTAAWNGAQRALNPRTFVPGNTYCFSVVASFIEGASSTTFCMKLQYVDGSGTQR
YDTIDMKTVGPNQWVHLYNPQYRIPSDATDMYVYVETADDTINFYIDEAIGAVAGTVIEG
PAPQPTQPPVLLGDVNGDGTINSTDLTMLKRSVLRAITLTDDAKARADVDKNGSINSTDV
LLLSRYLLRVIDKFPVAENPSSSFKYESAVQYRPAPDSYLNPCPQAGRIVKETYTGINGT
KSLNVYLPYGYDPNKKYNIFYLMHGGGENENTIFSNDVKLQNILDHAIMNGELEPLIVVT
PTFNGGNCTAQNFYQEFRQNVIPFVESKYSTYAESTTPQGIAASRMHRGFGGFSMGGLTT
WYVMVNCLDYVAYFMPLSGDYWYGNSPQDKANSIAEAINRSGLSKREYFVFAATGSDHIA
YANMNPQIEAMKALPHFDYTSDFSKGNFYFLVAPGATHWWGYVRHYIYDALPYFFHE
Number of residues
1077
Molecular Weight
119671.86
Theoretical pI
5.19
GO Classification
Functions
endo-1,4-beta-xylanase activity
Processes
xylan catabolic process
Components
cellulosome
General Function
Endo-1,4-beta-xylanase activity
Specific Function
Not Available
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Cytoplasmic
Gene sequence
>lcl|BSEQ0005873|3234 bp
ATGAAAAACAAGAGAGTTTTGGCAAAAATAACGGCTCTTGTGGTATTGCTGGGAGTGTTT
TTTGTATTACCGTCAAACATAAGTCAGCTATATGCTGATTATGAAGTGGTTCATGACACT
TTTGAAGTTAACTTTGACGGATGGTGTAACTTGGGAGTCGACACATATTTAACGGCAGTT
GAAAATGAAGGAAACAACGGTACAAGAGGTATGATGGTAATAAATCGCTCCAGTGCGAGT
GACGGTGCGTATTCGGAAAAAGGTTTCTATCTCGACGGTGGTGTAGAATACAAGTACAGT
GTTTTTGTAAAACACAACGGGACCGGCACCGAAACTTTCAAACTTTCTGTGTCCTATTTG
GATTCGGAAACAGAAGAAGAAAATAAGGAAGTAATTGCAACAAAGGATGTTGTGGCCGGA
GAATGGACTGAGATTTCGGCAAAATACAAAGCACCCAAAACTGCAGTGAATATTACTTTG
TCAATTACAACCGACAGCACTGTAGATTTCATTTTTGACGATGTAACCATAACCCGTAAA
GGAATGGCTGAGGCAAACACAGTATATGCAGCAAACGCTGTGCTGAAAGATATGTATGCA
AACTATTTCAGAGTTGGTTCGGTACTTAACTCCGGAACGGTAAACAATTCATCAATAAAG
GCCTTGATTTTAAGAGAGTTTAACAGTATTACCTGTGAAAATGAAATGAAGCCTGATGCC
ACACTGGTTCAATCAGGATCAACCAATACAAATATCAGGGTTTCTCTTAATCGTGCAGCA
AGTATTTTAAACTTCTGTGCACAAAATAATATAGCCGTCAGAGGTCATACACTGGTTTGG
CACAGCCAGACACCTCAATGGTTTTTCAAAGACAATTTCCAGGACAACGGAAACTGGGTT
TCCCAATCAGTTATGGACCAGCGTTTGGAAAGCTACATAAAAAATATGTTTGCTGAAATC
CAAAGACAGTATCCGTCTTTGAATCTTTATGCCTATGACGTTGTAAATGAGGCAGTAAGT
GATGATGCAAACAGGACCAGATATTATGGCGGGGCGAGGGAACCTGGATACGGAAATGGT
AGATCTCCATGGGTTCAGATCTACGGAGACAACAAATTTATTGAGAAAGCATTTACATAT
GCAAGAAAATATGCTCCGGCAAATTGTAAGCTTTACTACAACGATTACAACGAATATTGG
GATCATAAGAGAGACTGTATTGCCTCAATTTGTGCAAACTTGTACAACAAGGGCTTGCTT
GACGGTGTGGGAATGCAGTCCCATATTAATGCGGATATGAATGGATTCTCAGGTATACAA
AATTATAAAGCAGCTTTGCAGAAATATATAAATATCGGTTGTGATGTCCAAATTACCGAG
CTTGATATTAGTACAGAAAACGGCAAATTTAGCTTACAGCAGCAGGCTGATAAATATAAA
GCTGTTTTCCAGGCAGCTGTTGATATAAACAGAACCTCCAGCAAAGGAAAGGTTACGGCT
GTCTGTGTATGGGGACCTAATGACGCCAATACTTGGCTCGGTTCACAAAATGCACCTCTT
TTGTTTAACGCAAACAATCAACCGAAACCGGCATACAATGCGGTTGCATCCATTATTCCT
CAGTCCGAATGGGGCGACGGTAACAATCCGGCCGGCGGCGGAGGAGGAGGCAAACCGGAA
GAGCCGGATGCAAACGGATATTATTATCATGACACTTTTGAAGGAAGCGTAGGACAGTGG
ACAGCCAGAGGACCTGCGGAAGTTCTGCTTAGCGGAAGAACGGCTTACAAAGGTTCAGAA
TCACTCTTGGTAAGGAACCGTACGGCAGCATGGAACGGAGCACAACGGGCGCTGAATCCC
AGAACGTTTGTTCCCGGAAACACATATTGTTTCAGCGTAGTGGCATCGTTTATTGAAGGT
GCGTCTTCCACAACATTCTGCATGAAGCTGCAATACGTAGACGGAAGCGGCACTCAACGG
TATGATACCATAGATATGAAAACTGTGGGTCCAAATCAGTGGGTTCACCTGTACAATCCG
CAATACAGAATTCCTTCCGATGCAACAGATATGTATGTTTATGTGGAAACAGCGGATGAC
ACCATTAACTTCTACATAGATGAGGCAATCGGAGCGGTTGCCGGAACTGTAATCGAAGGA
CCTGCTCCACAGCCTACACAGCCTCCGGTACTGCTTGGCGATGTAAACGGTGATGGAACC
ATTAACTCAACTGACTTGACAATGTTAAAGAGAAGCGTGTTGAGGGCAATCACCCTTACC
GACGATGCAAAGGCTAGAGCAGACGTTGACAAGAATGGATCGATAAACAGCACTGATGTT
TTACTTCTTTCACGCTACCTTTTAAGAGTAATCGACAAATTTCCTGTAGCAGAAAATCCT
TCTTCTTCTTTTAAATATGAGTCGGCCGTGCAATATCGGCCGGCTCCTGATTCTTATTTA
AACCCTTGTCCGCAGGCGGGAAGAATTGTCAAGGAAACATATACAGGAATAAACGGAACT
AAGAGTCTTAATGTATATCTTCCATACGGTTATGATCCGAACAAAAAATATAACATTTTC
TACCTTATGCATGGCGGCGGTGAAAATGAGAATACGATTTTCAGCAACGATGTTAAATTG
CAAAATATCCTTGACCACGCGATTATGAACGGTGAACTTGAGCCTTTGATTGTAGTAACA
CCCACTTTCAACGGCGGAAACTGCACGGCCCAAAACTTTTATCAGGAATTCAGGCAAAAT
GTCATTCCTTTTGTGGAAAGCAAGTACTCTACTTATGCAGAATCAACAACCCCACAGGGA
ATAGCCGCTTCAAGAATGCACAGAGGTTTCGGCGGATTCTCAATGGGAGGATTGACAACA
TGGTATGTAATGGTTAACTGCCTTGATTACGTTGCATATTTTATGCCTTTAAGCGGTGAC
TACTGGTATGGAAACAGTCCGCAGGATAAGGCTAATTCAATTGCTGAAGCAATTAACAGA
TCCGGACTTTCAAAGAGGGAGTATTTCGTATTTGCGGCCACCGGTTCCGACCATATTGCA
TATGCTAATATGAATCCTCAAATTGAAGCTATGAAGGCTTTGCCGCATTTTGATTATACT
TCGGATTTTTCCAAAGGTAATTTTTACTTTCTTGTAGCTCCGGGCGCCACTCACTGGTGG
GGATACGTAAGACATTATATTTATGATGCACTTCCATATTTCTTCCATGAATGA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP51584
UniProtKB Entry NameXYNY_CLOTM
GenBank Gene IDX83269
General References
  1. Fontes CM, Hazlewood GP, Morag E, Hall J, Hirst BH, Gilbert HJ: Evidence for a general role for non-catalytic thermostabilizing domains in xylanases from thermophilic bacteria. Biochem J. 1995 Apr 1;307 ( Pt 1):151-8. [PubMed:7717969]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB04522DexfosfoserineexperimentalunknownDetails
DB07767Ferulic acidexperimentalunknownDetails
DB08587SINAPINATEexperimentalunknownDetails
DB08589SYRINGATEexperimentalunknownDetails
DB08711Methyl vanillateexperimentalunknownDetails