Cytochrome c-552

Details

Name
Cytochrome c-552
Synonyms
  • Cytochrome c552
Gene Name
cycM
Organism
Paracoccus denitrificans
Amino acid sequence
>lcl|BSEQ0012137|Cytochrome c-552
MFDTMTVTKAAGALIGSLLFLLLMSWAASGIFHVGTSGHGAEGEEHAQAYTYPVESAGGA
EGEAVDEGPDFATVLASADPAAGEKVFGKCKACHKLDGNDGVGPHLNGVVGRTVAGVDGF
NYSDPMKAHGGDWTPEALQEFLTNPKAVVKGTKMAFAGLPKIEDRANLIAYLEGQQ
Number of residues
176
Molecular Weight
18209.365
Theoretical pI
4.67
GO Classification
Functions
electron carrier activity / heme binding / metal ion binding
Processes
oxidation-reduction process
Components
integral component of membrane / plasma membrane
General Function
Metal ion binding
Specific Function
Mediates the electron transport between the cytochrome bc1 complex and cytochrome-c oxidase.
Pfam Domain Function
Transmembrane Regions
12-32
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0005963|531 bp
ATGTTCGATACCATGACCGTCACCAAGGCAGCCGGTGCGCTGATCGGCTCGCTTCTGTTC
CTTCTGCTGATGAGCTGGGCGGCATCGGGTATCTTTCACGTCGGCACCTCGGGCCACGGC
GCCGAGGGCGAAGAGCATGCCCAGGCATATACCTACCCGGTCGAGAGCGCCGGCGGCGCC
GAGGGCGAGGCCGTGGACGAAGGCCCCGATTTTGCCACCGTCCTGGCCTCGGCCGATCCC
GCCGCTGGCGAGAAGGTGTTCGGCAAGTGCAAGGCCTGCCACAAGCTGGACGGCAACGAT
GGCGTCGGCCCGCATCTGAACGGCGTCGTCGGCCGCACGGTCGCAGGCGTCGATGGCTTC
AACTATTCCGACCCGATGAAGGCGCATGGCGGCGACTGGACCCCCGAGGCGCTGCAGGAA
TTCCTGACCAACCCGAAAGCGGTGGTCAAGGGCACCAAAATGGCCTTCGCCGGCCTGCCC
AAGATCGAGGATCGCGCCAACCTGATCGCCTATCTGGAAGGCCAGCAGTAA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP54820
UniProtKB Entry NameCY552_PARDE
GenBank Gene IDX70367
General References
  1. Turba A, Jetzek M, Ludwig B: Purification of Paracoccus denitrificans cytochrome c552 and sequence analysis of the gene. Eur J Biochem. 1995 Jul 1;231(1):259-65. [PubMed:7628479]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB03317Heme CexperimentalunknownDetails