Protoporphyrinogen oxidase

Details

Name
Protoporphyrinogen oxidase
Synonyms
  • 1.3.3.4
  • PPO
Gene Name
hemY
Organism
Myxococcus xanthus
Amino acid sequence
>lcl|BSEQ0012653|Protoporphyrinogen oxidase
MHHMPRTTGMNVAVVGGGISGLAVAHHLRSRGTDAVLLESSARLGGAVGTHALAGYLVEQ
GPNSFLDREPATRALAAALNLEGRIRAADPAAKRRYVYTRGRLRSVPASPPAFLASDILP
LGARLRVAGELFSRRAPEGVDESLAAFGRRHLGHRATQVLLDAVQTGIYAGDVEQLSVAA
TFPMLVKMEREHRSLILGAIRAQKAQRQAALPAGTAPKLSGALSTFDGGLQVLIDALAAS
LGDAAHVGARVEGLAREDGGWRLIIEEHGRRAELSVAQVVLAAPAHATAKLLRPLDDALA
ALVAGIAYAPIAVVHLGFDAGTLPAPDGFGFLVPAEEQRRMLGAIHASTTFPFRAEGGRV
LYSCMVGGARQPGLVEQDEDALAALAREELKALAGVTARPSFTRVFRWPLGIPQYNLGHL
ERVAAIDAALQRLPGLHLIGNAYKGVGLNDCIRNAAQLADALVAGNTSHAP
Number of residues
471
Molecular Weight
49387.12
Theoretical pI
9.76
GO Classification
Functions
oxygen-dependent protoporphyrinogen oxidase activity
Processes
protoporphyrinogen IX biosynthetic process
Components
cytoplasm / membrane
General Function
Oxygen-dependent protoporphyrinogen oxidase activity
Specific Function
Catalyzes the 6-electron oxidation of protoporphyrinogen-IX to form protoporphyrin-IX.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Cytoplasm
Gene sequence
>lcl|BSEQ0007299|690 bp
ATGCGCTACGTCATCACCGGAGCGAGCAGGGGGATTGGTTTCGAATTCGTCCAGCAGCTC
CTGCTGCGGGGCGATACCGTCGAAGCCGGGGTCAGGTCGCCAGAGGGAGCACGGCGGCTG
GAGCCGTTGAAACAGAAGGCGGGCAACCGCCTGCGCATCCATGCGCTGGACGTGGGAGAC
GACGACAGCGTGCGCGCGTTCGCCACCAACGTGTGTACCGGTCCCGTGGACGTGCTCATC
AACAACGCCGGTGTCTCCGGCTTGTGGTGCGCGTTGGGTGACGTGGACTACGCGGACATG
GCGCGCACGTTCACCATCAACGCCCTGGGGCCGCTGCGTGTCACCAGCGCGATGCTGCCG
GGCTTGCGGCAAGGCGCCTTGCGGCGGGTGGCGCACGTCACCTCGCGGATGGGCTCGTTG
GCGGCGAACACCGACGGGGGGGCCTATGCGTACCGCATGTCGAAGGCCGCGCTGAACATG
GCCGTGCGCTCCATGTCCACGGACCTGCGCCCGGAGGGCTTCGTCACCGTGCTGCTCCAC
CCCGGTTGGGTGCAGACGGACATGGGCGGCCCGGACGCCACGCTGCCGGCGCCGGATTCG
GTGCGCGGCATGCTGCGGGTCATCGACGGGCTGAACCCGGAGCACAGCGGCCGGTTCTTC
GACTACCAGGGGACCGAAGTGCCCTGGTAG
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP56601
UniProtKB Entry NamePPOX_MYXXA
GenBank Protein ID20800464
GenBank Gene IDL27429
General References
  1. Li S, Lee BU, Shimkets LJ: csgA expression entrains Myxococcus xanthus development. Genes Dev. 1992 Mar;6(3):401-10. [PubMed:1372277]
  2. Dailey HA, Dailey TA: Protoporphyrinogen oxidase of Myxococcus xanthus. Expression, purification, and characterization of the cloned enzyme. J Biol Chem. 1996 Apr 12;271(15):8714-8. [PubMed:8621504]
  3. Corradi HR, Corrigall AV, Boix E, Mohan CG, Sturrock ED, Meissner PN, Acharya KR: Crystal structure of protoporphyrinogen oxidase from Myxococcus xanthus and its complex with the inhibitor acifluorfen. J Biol Chem. 2006 Dec 15;281(50):38625-33. Epub 2006 Oct 17. [PubMed:17046834]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB07338AcifluorfenexperimentalunknownDetails