2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase

Details

Name
2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
Synonyms
  • 4.6.1.12
  • MECDP-synthase
Gene Name
ispF
Organism
Shigella flexneri
Amino acid sequence
>lcl|BSEQ0010908|2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
MRIGHGFDVHAFGGEGPIIIGGVRIPYEKGLLAHSDGDVALHALTDALLGAAALGDIGKL
FPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTIIAQAPKMLPHIPQMRVFIAEDL
GCHMDDVNVKATTTEKLGFTGRGEGIACEAVALLIKATK
Number of residues
159
Molecular Weight
16897.37
Theoretical pI
6.51
GO Classification
Functions
2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase activity / metal ion binding
Processes
isopentenyl diphosphate biosynthetic process, methylerythritol 4-phosphate pathway / terpenoid biosynthetic process
General Function
Metal ion binding
Specific Function
Involved in the biosynthesis of isopentenyl diphosphate (IPP) and dimethylallyl diphosphate (DMAPP), two major building blocks of isoprenoid compounds. Catalyzes the conversion of 4-diphosphocytidyl-2-C-methyl-D-erythritol 2-phosphate (CDP-ME2P) to 2-C-methyl-D-erythritol 2,4-cyclodiphosphate (ME-CPP) with a corresponding release of cytidine 5-monophosphate (CMP).
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Not Available
Gene sequence
>lcl|BSEQ0010909|2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (ispF)
ATGCGAATTGGACACGGTTTTGACGTACACGCCTTTGGCGGTGAAGGCCCAATTATCATT
GGTGGCGTACGCATTCCTTACGAAAAAGGATTGCTGGCGCATTCTGATGGCGACGTGGCG
CTTCATGCGTTGACCGATGCATTGCTTGGCGCGGCGGCGCTGGGGGATATCGGCAAACTG
TTCCCGGATACCGATCCGGCATTTAAAGGTGCCGACAGCCGCGAGCTGCTACGCGAAGCC
TGGCGTCGTATTCAGGCGAAGGGTTATACCCTTGGCAACGTCGATGTCACTATCATCGCT
CAGGCACCGAAGATGTTGCCGCACATTCCACAAATGCGCGTGTTTATTGCCGAAGATCTC
GGCTGCCATATGGATGATGTTAACGTGAAAGCCACTACTACGGAAAAACTTGGATTTACC
GGACGTGGGGAAGGGATTGCCTGTGAAGCGGTGGCGCTACTCATTAAGGCAACAAAATGA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP62619
UniProtKB Entry NameISPF_SHIFL
GenBank Protein ID24053164
GenBank Gene IDAE005674
General References
  1. Jin Q, Yuan Z, Xu J, Wang Y, Shen Y, Lu W, Wang J, Liu H, Yang J, Yang F, Zhang X, Zhang J, Yang G, Wu H, Qu D, Dong J, Sun L, Xue Y, Zhao A, Gao Y, Zhu J, Kan B, Ding K, Chen S, Cheng H, Yao Z, He B, Chen R, Ma D, Qiang B, Wen Y, Hou Y, Yu J: Genome sequence of Shigella flexneri 2a: insights into pathogenicity through comparison with genomes of Escherichia coli K12 and O157. Nucleic Acids Res. 2002 Oct 15;30(20):4432-41. [PubMed:12384590]
  2. Wei J, Goldberg MB, Burland V, Venkatesan MM, Deng W, Fournier G, Mayhew GF, Plunkett G 3rd, Rose DJ, Darling A, Mau B, Perna NT, Payne SM, Runyen-Janecky LJ, Zhou S, Schwartz DC, Blattner FR: Complete genome sequence and comparative genomics of Shigella flexneri serotype 2a strain 2457T. Infect Immun. 2003 May;71(5):2775-86. [PubMed:12704152]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB018594-CDP-2-C-methyl-D-erythritol 2-phosphateexperimentalunknownDetails
DB02552Geranyl DiphosphateexperimentalunknownDetails
DB03403Cytidine-5'-MonophosphateexperimentalunknownDetails
DB036874-(Cytidine 5'-diphospho)-2-C-methyl-D-erythritolexperimentalunknownDetails
DB039612c-Methyl-D-Erythritol 2,4-CyclodiphosphateexperimentalunknownDetails
DB04555Cytidine-5'-DiphosphateexperimentalunknownDetails