Histamine H1 receptor

Details

Name
Histamine H1 receptor
Synonyms
  • Bphs
  • H1R
Gene Name
Hrh1
Organism
Mouse
Amino acid sequence
>lcl|BSEQ0051318|Histamine H1 receptor
MSLPNTSSASEDKMCEGNRTAMASPQLLPLVVVLSSISLVTVGLNLLVLYAVRSERKLHT
VGNLYIVSLSVADLIVGAVVMPMNILYLIMTKWSLGRPLCLFWLSMDYVASTASIFSVFI
LCIDRYRSVQQPLRYLRYRTKTRASATILGAWFLSFLWVIPILGWHHFTPLAPELREDKC
ETDFYNVTWFKIMTAIINFYLPTLLMLWFYVKIYKAVRRHCQHRQLTNGSLPTFLEIKLR
SEDAKEGAKKPGKESPWGVQKRPSRDPTGGLDQKSTSEDPKVTSPTVFSQEGERETVTRP
CFRLDVMQTQPVPEGDARGSKANDQTLSQPKMDEQSLSTCRRISETSEDQTLVDRQSFSR
TTDSDTSIEPGLGKVKARSRSNSGLDYIKVTWKRLRSHSRQYVSGLHLNRERKAAKQLGC
IMAAFILCWIPYFIFFMVIAFCNSCCSEPVHMFTIWLGYINSTLNPLIYPLCNENFKKTF
KKILHIRS
Number of residues
488
Molecular Weight
55681.225
Theoretical pI
Not Available
GO Classification
Functions
calcium ion transmembrane transporter activity / histamine receptor activity
Processes
calcium ion import / cellular response to histamine / eosinophil chemotaxis / G-protein coupled receptor signaling pathway / inflammatory response / manganese ion transmembrane transport / memory / phospholipase C-activating G-protein coupled receptor signaling pathway / positive regulation of vasoconstriction / regulation of synaptic plasticity / regulation of vascular permeability / regulation of vasoconstriction / rhythmic process / visual learning
Components
cytosol / integral component of plasma membrane / plasma membrane
General Function
In peripheral tissues, the H1 subclass of histamine receptors mediates the contraction of smooth muscles, increase in capillary permeability due to contraction of terminal venules, and catecholamine release from adrenal medulla, as well as mediating neurotransmission in the central nervous system. Involved in circadian rhythm of locomotor activity and exploratory behavior. Also involved in responsiveness to pertussis toxin through its control of susceptibility to histamine hypersensitivity and enhancement of antigen-specific delayed-type hypersensitivity responses.
Specific Function
Calcium ion transmembrane transporter activity
Pfam Domain Function
Transmembrane Regions
30-52 63-83 102-123 144-164 190-210 418-439 452-471
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0051319|Histamine H1 receptor (Hrh1)
ATGAGCCTTCCCAACACCTCTTCTGCCTCCGAAGACAAGATGTGTGAGGGGAACAGGACA
GCCATGGCCAGCCCTCAGCTGCTGCCCCTGGTGGTGGTTCTAAGTAGTATCTCCCTGGTC
ACAGTGGGCCTCAACCTGCTGGTGCTGTATGCAGTGCGCAGTGAGCGCAAGCTACACACC
GTGGGCAACCTGTACATTGTCAGCCTGTCGGTAGCAGACCTGATTGTAGGGGCAGTCGTC
ATGCCCATGAACATCCTCTATCTTATCATGACCAAGTGGTCCCTGGGCCGCCCCCTCTGC
CTCTTTTGGCTCTCTATGGATTATGTGGCCAGCACGGCATCCATCTTTAGTGTCTTCATC
CTGTGTATTGATCGCTACCGCTCTGTCCAGCAACCCCTCCGGTACCTGAGGTATCGAACC
AAGACCCGTGCTTCAGCTACCATCCTGGGGGCCTGGTTTCTCTCCTTCCTGTGGGTTATA
CCTATACTTGGCTGGCATCACTTCACGCCCCTGGCCCCAGAGCTTCGGGAAGATAAGTGT
GAGACAGATTTCTACAATGTCACTTGGTTCAAGATCATGACCGCCATCATCAACTTCTAC
CTCCCCACTTTGCTCATGCTGTGGTTCTATGTGAAGATCTACAAGGCTGTGCGGCGACAC
TGTCAGCACCGCCAGCTCACCAACGGGTCCCTCCCTACCTTTTTAGAAATCAAGCTGAGG
TCGGAGGATGCCAAAGAGGGTGCCAAGAAACCTGGGAAAGAGTCTCCCTGGGGGGTCCAG
AAGAGGCCGTCAAGAGACCCTACTGGAGGTCTGGATCAGAAGTCAACATCTGAAGACCCC
AAGGTGACCTCTCCGACTGTCTTCAGCCAAGAGGGGGAAAGGGAAACAGTCACACGCCCC
TGTTTCCGTCTTGACGTCATGCAGACACAGCCTGTGCCTGAGGGAGATGCCAGGGGCTCA
AAGGCCAATGACCAGACCTTGAGCCAGCCCAAAATGGATGAGCAGAGCCTGAGTACTTGC
CGGCGGATCAGTGAGACATCAGAGGACCAGACCTTGGTGGATCGACAGTCCTTCTCCCGG
ACCACAGACTCAGACACCAGCATAGAGCCAGGGCTGGGCAAAGTCAAAGCGAGAAGCAGG
TCTAACAGTGGCCTGGACTACATCAAAGTCACCTGGAAGAGGCTCCGCTCACATTCCAGA
CAGTATGTGTCCGGGTTGCACTTGAACCGAGAGCGGAAGGCAGCCAAGCAGTTGGGTTGT
ATCATGGCAGCATTCATTCTCTGCTGGATTCCCTATTTCATCTTCTTCATGGTCATTGCC
TTCTGCAACAGCTGCTGCAGCGAACCTGTGCACATGTTCACCATTTGGCTGGGCTACATC
AACTCCACGCTGAACCCCCTCATCTACCCGCTGTGCAACGAGAACTTCAAGAAGACATTC
AAAAAAATTCTGCACATTCGTTCCTAA
Chromosome Location
6
Locus
6 53.05 cM
External Identifiers
ResourceLink
UniProtKB IDP70174
UniProtKB Entry NameHRH1_MOUSE
General References
  1. Inoue I, Taniuchi I, Kitamura D, Jenkins NA, Gilbert DJ, Copeland NG, Watanabe T: Characteristics of the mouse genomic histamine H1 receptor gene. Genomics. 1996 Aug 15;36(1):178-81. [PubMed:8812432]
  2. Ma RZ, Gao J, Meeker ND, Fillmore PD, Tung KS, Watanabe T, Zachary JF, Offner H, Blankenhorn EP, Teuscher C: Identification of Bphs, an autoimmune disease locus, as histamine receptor H1. Science. 2002 Jul 26;297(5581):620-3. [PubMed:12142541]
  3. Carninci P, Kasukawa T, Katayama S, Gough J, Frith MC, Maeda N, Oyama R, Ravasi T, Lenhard B, Wells C, Kodzius R, Shimokawa K, Bajic VB, Brenner SE, Batalov S, Forrest AR, Zavolan M, Davis MJ, Wilming LG, Aidinis V, Allen JE, Ambesi-Impiombato A, Apweiler R, Aturaliya RN, Bailey TL, Bansal M, Baxter L, Beisel KW, Bersano T, Bono H, Chalk AM, Chiu KP, Choudhary V, Christoffels A, Clutterbuck DR, Crowe ML, Dalla E, Dalrymple BP, de Bono B, Della Gatta G, di Bernardo D, Down T, Engstrom P, Fagiolini M, Faulkner G, Fletcher CF, Fukushima T, Furuno M, Futaki S, Gariboldi M, Georgii-Hemming P, Gingeras TR, Gojobori T, Green RE, Gustincich S, Harbers M, Hayashi Y, Hensch TK, Hirokawa N, Hill D, Huminiecki L, Iacono M, Ikeo K, Iwama A, Ishikawa T, Jakt M, Kanapin A, Katoh M, Kawasawa Y, Kelso J, Kitamura H, Kitano H, Kollias G, Krishnan SP, Kruger A, Kummerfeld SK, Kurochkin IV, Lareau LF, Lazarevic D, Lipovich L, Liu J, Liuni S, McWilliam S, Madan Babu M, Madera M, Marchionni L, Matsuda H, Matsuzawa S, Miki H, Mignone F, Miyake S, Morris K, Mottagui-Tabar S, Mulder N, Nakano N, Nakauchi H, Ng P, Nilsson R, Nishiguchi S, Nishikawa S, Nori F, Ohara O, Okazaki Y, Orlando V, Pang KC, Pavan WJ, Pavesi G, Pesole G, Petrovsky N, Piazza S, Reed J, Reid JF, Ring BZ, Ringwald M, Rost B, Ruan Y, Salzberg SL, Sandelin A, Schneider C, Schonbach C, Sekiguchi K, Semple CA, Seno S, Sessa L, Sheng Y, Shibata Y, Shimada H, Shimada K, Silva D, Sinclair B, Sperling S, Stupka E, Sugiura K, Sultana R, Takenaka Y, Taki K, Tammoja K, Tan SL, Tang S, Taylor MS, Tegner J, Teichmann SA, Ueda HR, van Nimwegen E, Verardo R, Wei CL, Yagi K, Yamanishi H, Zabarovsky E, Zhu S, Zimmer A, Hide W, Bult C, Grimmond SM, Teasdale RD, Liu ET, Brusic V, Quackenbush J, Wahlestedt C, Mattick JS, Hume DA, Kai C, Sasaki D, Tomaru Y, Fukuda S, Kanamori-Katayama M, Suzuki M, Aoki J, Arakawa T, Iida J, Imamura K, Itoh M, Kato T, Kawaji H, Kawagashira N, Kawashima T, Kojima M, Kondo S, Konno H, Nakano K, Ninomiya N, Nishio T, Okada M, Plessy C, Shibata K, Shiraki T, Suzuki S, Tagami M, Waki K, Watahiki A, Okamura-Oho Y, Suzuki H, Kawai J, Hayashizaki Y: The transcriptional landscape of the mammalian genome. Science. 2005 Sep 2;309(5740):1559-63. [PubMed:16141072]
  4. Inoue I, Yanai K, Kitamura D, Taniuchi I, Kobayashi T, Niimura K, Watanabe T, Watanabe T: Impaired locomotor activity and exploratory behavior in mice lacking histamine H1 receptors. Proc Natl Acad Sci U S A. 1996 Nov 12;93(23):13316-20. [PubMed:8917588]
  5. Gao JF, Call SB, Fillmore PD, Watanabe T, Meeker ND, Teuscher C: Analysis of the role of Bphs/Hrh1 in the genetic control of responsiveness to pertussis toxin. Infect Immun. 2003 Mar;71(3):1281-7. [PubMed:12595443]
  6. Huttlin EL, Jedrychowski MP, Elias JE, Goswami T, Rad R, Beausoleil SA, Villen J, Haas W, Sowa ME, Gygi SP: A tissue-specific atlas of mouse protein phosphorylation and expression. Cell. 2010 Dec 23;143(7):1174-89. doi: 10.1016/j.cell.2010.12.001. [PubMed:21183079]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00512VancomycinapprovednosubstrateDetails
DB11160Phenyltoloxamineapprovedyesinverse agonistDetails