Split-Soret cytochrome c

Details

Name
Split-Soret cytochrome c
Synonyms
Not Available
Gene Name
Not Available
Organism
Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949)
Amino acid sequence
>lcl|BSEQ0019366|Split-Soret cytochrome c
MNIGRRDLICGLGGLAVGGAMLGLGSVEARAAGQAQPASGRFDQVGGAFGWKPHKLDPKE
CAQVAYDGYWYKGFGCGFGAFYSIVGLMGEKYGAPYNQFPFAMLEANKGGISDWGTICGA
LYGAAATFSLFWGRKEVHPMVNELFRWYEVTKLPIFNPGDAAQGVKGDLPMSASDSVLCH
ISVSKWCYENKIEATSKQRSERCGRLTADAAFKAAEIINTKIDQGKDFKSTFPMQASVSS
CGECHMTKGNDANWAKGIMDCTPCHSGTAATQNKFVNHP
Number of residues
279
Molecular Weight
29988.94
Theoretical pI
7.73
GO Classification
Functions
2 iron, 2 sulfur cluster binding / metal ion binding
Processes
anaerobic respiration
General Function
Metal ion binding
Specific Function
Diheme cytochrome c which may be involved in sulfate reduction.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Not Available
Gene sequence
>lcl|BSEQ0019367|Split-Soret cytochrome c
ATGAACATCGGCAGACGTGATCTTATCTGCGGCCTTGGCGGGCTTGCGGTGGGCGGAGCT
ATGCTCGGCCTTGGTAGTGTTGAGGCCAGGGCTGCGGGGCAGGCGCAGCCTGCGTCGGGT
CGCTTTGACCAGGTGGGCGGAGCCTTTGGCTGGAAGCCCCACAAGCTTGACCCCAAGGAA
TGCGCCCAGGTGGCCTATGACGGTTACTGGTACAAGGGCTTCGGCTGTGGGTTCGGCGCG
TTTTACAGTATTGTCGGCCTGATGGGCGAAAAATACGGCGCGCCTTACAACCAGTTTCCC
TTTGCCATGCTTGAAGCAAACAAGGGCGGCATTTCTGACTGGGGAACCATCTGTGGCGCT
CTTTACGGTGCCGCTGCGACATTTTCGCTGTTCTGGGGCCGCAAGGAAGTGCACCCCATG
GTCAACGAGCTGTTCCGCTGGTACGAAGTGACCAAGCTGCCCATTTTCAACCCCGGTGAT
GCAGCCCAGGGCGTCAAGGGCGATCTGCCCATGAGCGCTTCTGACTCTGTACTGTGCCAC
ATTTCCGTGTCCAAGTGGTGTTATGAAAACAAGATCGAGGCTACCAGCAAGCAGCGCAGC
GAGCGTTGTGGCCGTCTTACTGCAGACGCTGCCTTCAAGGCTGCCGAAATAATCAATACC
AAGATCGATCAGGGCAAGGACTTCAAGAGCACCTTCCCCATGCAGGCGTCCGTCAGCAGT
TGCGGCGAGTGCCATATGACCAAGGGCAATGACGCCAACTGGGCCAAGGGCATCATGGAC
TGCACCCCCTGCCACAGCGGCACGGCGGCAACGCAGAACAAGTTTGTCAATCATCCCTAA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP81040
UniProtKB Entry NameCYCX_DESDA
General References
  1. Devreese B, Costa C, Demol H, Papaefthymiou V, Moura I, Moura JJ, Van Beeumen J: The primary structure of the split-Soret cytochrome c from Desulfovibrio desulfuricans ATCC 27774 reveals an unusual type of diheme cytochrome c. Eur J Biochem. 1997 Sep 1;248(2):445-51. [PubMed:9346301]
  2. Moura JJ, Costa C, Liu MY, Moura I, LeGall J: Structural and functional approach toward a classification of the complex cytochrome c system found in sulfate-reducing bacteria. Biochim Biophys Acta. 1991 May 23;1058(1):61-6. [PubMed:1646022]
  3. Abreu IA, Lourenco AI, Xavier AV, LeGall J, Coelho AV, Matias PM, Pinto DM, Armenia Carrondo M, Teixeira M, Saraiva LM: A novel iron centre in the split-Soret cytochrome c from Desulfovibrio desulfuricans ATCC 27774. J Biol Inorg Chem. 2003 Feb;8(3):360-70. Epub 2002 Dec 19. [PubMed:12589573]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB03317Heme CexperimentalunknownDetails