Cytochrome b6-f complex subunit 5

Details

Name
Cytochrome b6-f complex subunit 5
Synonyms
  • Cytochrome b6-f complex subunit PetG
  • Cytochrome b6-f complex subunit V
Gene Name
petG
Organism
Mastigocladus laminosus
Amino acid sequence
>lcl|BSEQ0012724|Cytochrome b6-f complex subunit 5
MVEPLLDGLVLGLVFATLGGLFYAAYQQYKRPNELGG
Number of residues
37
Molecular Weight
4014.67
Theoretical pI
4.43
GO Classification
Functions
electron transporter, transferring electrons within cytochrome b6/f complex of photosystem II activity
Processes
cytochrome complex assembly / oxidation-reduction process / photosynthesis
Components
cytochrome b6f complex / integral component of membrane / thylakoid membrane
General Function
Electron transporter, transferring electrons within cytochrome b6/f complex of photosystem ii activity
Specific Function
Component of the cytochrome b6-f complex, which mediates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions. PetG is required for either the stability or assembly of the cytochrome b6-f complex.
Pfam Domain Function
Transmembrane Regions
5-25
Cellular Location
Cellular thylakoid membrane
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP83797
UniProtKB Entry NamePETG_MASLA
General References
  1. Kurisu G, Zhang H, Smith JL, Cramer WA: Structure of the cytochrome b6f complex of oxygenic photosynthesis: tuning the cavity. Science. 2003 Nov 7;302(5647):1009-14. Epub 2003 Oct 2. [PubMed:14526088]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB04646DibromothymoquinoneexperimentalunknownDetails
DB084532-NONYL-4-HYDROXYQUINOLINE N-OXIDEexperimentalunknownDetails