Osmotically inducible protein C

Details

Name
Osmotically inducible protein C
Synonyms
Not Available
Gene Name
tthHB8IM
Organism
Thermus thermophilus
Amino acid sequence
>lcl|BSEQ0005303|Osmotically inducible protein C
MPVRKAKAVWEGGLRQGKGVMELQSQAFQGPYSYPSRFEEGEGTNPEELIAAAHAGXFSM
ALAASLEREGFPPKRVSTEARVHLEVVDGKPTLTRIELLTEAEVPGISSEKFLEIAEAAK
EGCPVSRALAGVKEVVLTARLV
Number of residues
142
Molecular Weight
Not Available
Theoretical pI
5.32
GO Classification
Functions
peroxidase activity
Processes
response to oxidative stress
General Function
Not Available
Specific Function
Peroxidase activity
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Not Available
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP84124
UniProtKB Entry NameP84124_THETH
General References
  1. Rehse PH, Ohshima N, Nodake Y, Tahirov TH: Crystallographic structure and biochemical analysis of the Thermus thermophilus osmotically inducible protein C. J Mol Biol. 2004 May 14;338(5):959-68. [PubMed:15111059]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB021533-sulfino-L-alanineexperimentalunknownDetails