3-alpha-(or 20-beta)-hydroxysteroid dehydrogenase

Details

Name
3-alpha-(or 20-beta)-hydroxysteroid dehydrogenase
Synonyms
  • 1.1.1.53
Gene Name
fabG3
Organism
Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Amino acid sequence
>lcl|BSEQ0051245|3-alpha-(or 20-beta)-hydroxysteroid dehydrogenase
MSGRLIGKVALVSGGARGMGASHVRAMVAEGAKVVFGDILDEEGKAVAAELADAARYVHL
DVTQPAQWTAAVDTAVTAFGGLHVLVNNAGILNIGTIEDYALTEWQRILDVNLTGVFLGI
RAVVKPMKEAGRGSIINISSIEGLAGTVACHGYTATKFAVRGLTKSTALELGPSGIRVNS
IHPGLVKTPMTDWVPEDIFQTALGRAAEPVEVSNLVVYLASDESSYSTGAEFVVDGGTVA
GLAHNDFGAVEVSSQPEWVT
Number of residues
260
Molecular Weight
27029.535
Theoretical pI
Not Available
GO Classification
Functions
androstan-3-alpha,17-beta-diol dehydrogenase activity
Processes
C21-steroid hormone metabolic process / steroid metabolic process
Components
plasma membrane
General Function
Not Available
Specific Function
Androstan-3-alpha,17-beta-diol dehydrogenase activity
Pfam Domain Function
Not Available
Transmembrane Regions
Not Available
Cellular Location
Not Available
Gene sequence
>lcl|BSEQ0051246|3-alpha-(or 20-beta)-hydroxysteroid dehydrogenase (fabG3)
ATGTCTGGACGGTTGATAGGAAAGGTCGCACTTGTCAGCGGCGGGGCGCGCGGTATGGGT
GCATCCCATGTGCGGGCGATGGTGGCCGAAGGCGCAAAGGTTGTGTTCGGCGACATCCTC
GACGAGGAGGGCAAGGCGGTGGCCGCCGAACTGGCCGATGCGGCCCGCTACGTCCATCTC
GACGTTACCCAACCCGCGCAATGGACGGCTGCGGTGGACACCGCGGTCACCGCATTCGGT
GGCCTGCACGTGCTGGTCAACAACGCCGGCATTCTCAACATCGGGACGATCGAGGACTAC
GCCCTCACCGAATGGCAGCGCATCCTCGATGTCAACCTGACCGGAGTCTTCCTGGGCATC
CGCGCTGTCGTCAAGCCAATGAAAGAGGCTGGTCGCGGCTCCATCATCAACATTTCGTCG
ATCGAGGGGCTGGCCGGCACGGTTGCTTGTCATGGCTATACCGCCACCAAGTTCGCCGTG
CGGGGGCTGACCAAGTCCACCGCTCTCGAGTTGGGGCCCAGCGGAATTCGAGTCAACTCG
ATTCACCCTGGGTTGGTCAAGACGCCGATGACTGACTGGGTCCCCGAAGACATCTTCCAG
ACCGCGCTGGGCCGCGCGGCCGAACCCGTGGAAGTGTCCAACCTCGTCGTCTACCTGGCC
AGCGATGAGTCGAGCTATTCCACCGGCGCGGAATTTGTGGTCGACGGCGGGACCGTAGCT
GGCCTGGCACACAACGACTTCGGTGCCGTCGAGGTGTCCTCGCAGCCGGAATGGGTGACG
TAA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDP9WGT1
UniProtKB Entry NameHSD_MYCTU
General References
  1. Cole ST, Brosch R, Parkhill J, Garnier T, Churcher C, Harris D, Gordon SV, Eiglmeier K, Gas S, Barry CE 3rd, Tekaia F, Badcock K, Basham D, Brown D, Chillingworth T, Connor R, Davies R, Devlin K, Feltwell T, Gentles S, Hamlin N, Holroyd S, Hornsby T, Jagels K, Krogh A, McLean J, Moule S, Murphy L, Oliver K, Osborne J, Quail MA, Rajandream MA, Rogers J, Rutter S, Seeger K, Skelton J, Squares R, Squares S, Sulston JE, Taylor K, Whitehead S, Barrell BG: Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence. Nature. 1998 Jun 11;393(6685):537-44. [PubMed:9634230]
  2. Kelkar DS, Kumar D, Kumar P, Balakrishnan L, Muthusamy B, Yadav AK, Shrivastava P, Marimuthu A, Anand S, Sundaram H, Kingsbury R, Harsha HC, Nair B, Prasad TS, Chauhan DS, Katoch K, Katoch VM, Kumar P, Chaerkady R, Ramachandran S, Dash D, Pandey A: Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry. Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3. [PubMed:21969609]
  3. Yang JK, Park MS, Waldo GS, Suh SW: Directed evolution approach to a structural genomics project: Rv2002 from Mycobacterium tuberculosis. Proc Natl Acad Sci U S A. 2003 Jan 21;100(2):455-60. Epub 2003 Jan 10. [PubMed:12524453]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB02854AetiocholanoloneexperimentalunknownDetails